KEGG   Nitrosospira multiformis: Nmul_A1867Help
Entry
Nmul_A1867        CDS       T00302                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00010  Glycolysis / Gluconeogenesis
nmu00620  Pyruvate metabolism
nmu00640  Propanoate metabolism
nmu00680  Methane metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1867
   00620 Pyruvate metabolism
    Nmul_A1867
   00640 Propanoate metabolism
    Nmul_A1867
  Energy metabolism
   00680 Methane metabolism
    Nmul_A1867
Enzymes [BR:nmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nmul_A1867
Lipid biosynthesis proteins [BR:nmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nmul_A1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N Cas_St_Csn2
Motif
Other DBs
NCBI-ProteinID: ABB75162
UniProt: Q2Y7V9
Position
2153459..2154511
Genome map
AA seq 350 aa AA seqDB search
MATIQSILNETRTFTPSASFVEQANVSGMEEYDALCAEAEKDEAAFWSRLARDHISWHKP
FTRVLDETNHPFFTWFDDGELNVSYNCLDRHQATQSDKVALIFEADDGTVTRCTYQDLYR
RVCRFANGLKSLNIRKGDRVVIYMPMSIEAVVAMLACARIGATHSVVFGGFSAKSLHERI
IDAGAVAVITADEQWRGGKINYLKAVVEDALGRGETDSVKSVVVYQRGSGDLQLDANRDI
WWHDLIRDQSETCEPEWVNAEHPLFTLYTSGSTGKPKGVQHSSAGFLLGAITSMQWIFDY
KSSDIFWCTADVGWVTGHTYVTYGPLAVGATQIIFEGAFLLILTRVASGK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgattcaatctatcctcaatgaaacacgcacctttacaccctccgcttcgttc
gtggaacaagcaaacgtatccggaatggaagaatatgatgccctttgcgcagaggcagaa
aaggatgaggcagcattctggtccagactggcgcgggatcatatttcctggcacaaacca
tttacccgcgtactggatgaaaccaaccatccgttctttacctggttcgatgacggagaa
ctgaatgtttcatacaattgtctcgatcggcaccaggccacccagtcggacaaggttgcg
cttattttcgaggcggatgacggcaccgtcacgcgctgcacctaccaggatctctaccgc
cgcgtatgcaggtttgcaaatggtctcaagtcgctgaatatcaggaaaggtgatcgcgtc
gttatctacatgccgatgagtatcgaggcggtagtggcaatgctggcctgcgcgcgcatc
ggtgcgacccattcagtcgtgttcggtggcttttccgccaaaagcctgcatgagcgaatt
atcgacgcaggcgcggtagccgtgattaccgcggacgagcaatggcgcggcggcaaaatc
aactacctgaaagccgttgtcgaagatgcgctcggtagaggtgaaacggactcggtgaaa
tccgtggtggtctaccagcgaggcagcggtgacctgcaactggacgccaatcgcgacatc
tggtggcatgatctcatccgggatcagagcgagacctgtgagcccgaatgggtgaacgcc
gagcatccgctatttacgctctacacctccggttccaccggcaagccaaaaggcgtgcaa
cactcttccgcgggctttctgctgggcgccatcacgagcatgcaatggattttcgactac
aagtcttccgatatcttctggtgcacggccgacgtaggctgggtcacggggcacacttat
gtgacttatggtccgctcgccgtcggggcgacccagatcatattcgaaggcgcgttccta
cttatcctgacgcgggtcgcttctggaaaatga

DBGET integrated database retrieval system