KEGG   Nitrosospira multiformis: Nmul_A1987
Entry
Nmul_A1987        CDS       T00302                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00785  Lipoic acid metabolism
nmu01100  Metabolic pathways
nmu01240  Biosynthesis of cofactors
Module
nmu_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Nmul_A1987
Enzymes [BR:nmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Nmul_A1987
SSDB
Motif
Pfam: Radical_SAM LIAS_N
Other DBs
NCBI-ProteinID: ABB75282
UniProt: Q2Y7I9
Position
complement(2284599..2285549)
AA seq 316 aa
MTIESRQKGVAKTARNPVKIAPQSTDQLLRKPSWIRVRSSNSQEFYEVKRILREQKLHTV
CEEASCPNIGECFGKGTATFMILGDLCTRRCPFCDVAHGRPRPPDPEEPLHLAQSIAAMK
LKYVVITSVDRDDLRDGGAQHFVDCIREVRAHSPQTKIEILVPDFRGRLDIALEKLFACP
PDVMNHNLETVPRLYRQCRPGADYTHSLRLLKEFKARFPGIPTKSGLMLGLGETDEEILD
VMRDLRKHDVEMLTIGQYLQPSIGHLPVMRYVTPGAFKEFERAAIEMGFSNAACGPMVRS
SYHADQQAHEAGIIQR
NT seq 951 nt   +upstreamnt  +downstreamnt
atgacaattgaaagtcgccagaaaggcgttgcaaaaaccgcgcgcaatcccgtcaaaatc
gcgccgcaatctaccgatcagttgctgcgtaaaccttcctggatcagggtgcgatcctcc
aatagccaggagttttatgaggtcaagcggattttgcgggagcagaagctgcacacggta
tgtgaggaagcttcctgtcccaacatcggcgaatgcttcggcaaaggcactgcaactttc
atgatactgggcgatctctgtacccggcgctgtcccttctgcgacgtggcgcatggccgg
ccgcgtcctccggaccccgaagaacctctgcacctcgcgcaatccattgccgccatgaag
ttgaaatatgtggttatcacgagcgttgaccgcgatgatctcagggatggaggagctcag
catttcgtggattgcatccgtgaggttcgagcccattcgccgcagacaaagatagagatc
ctggtgccggattttcgcgggagactggatattgcgctggaaaaattattcgcctgcccg
cccgatgtgatgaaccacaatctcgaaacggtaccccgcctctaccggcaatgccgtcca
ggcgcggactacacgcattcgctccggttattgaaggagttcaaggcacgttttccgggc
atccccaccaaatccggattgatgctgggactgggagaaactgacgaggagatcctcgac
gtgatgcgcgacttgcgcaagcatgatgtcgagatgcttaccattggccagtatctgcag
ccaagcatcggacatcttcctgtcatgcgttatgtcaccccgggggcatttaaggaattt
gaacgcgccgcgatcgaaatgggtttcagcaacgccgcgtgcgggcccatggtccggtcc
agctaccatgcggatcagcaggcgcatgaggcaggcatcatacagaggtag

DBGET integrated database retrieval system