KEGG   Nitrosospira multiformis: Nmul_A2562Help
Entry
Nmul_A2562        CDS       T00302                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01130  Biosynthesis of antibiotics
nmu01230  Biosynthesis of amino acids
Module
nmu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmul_A2562
Enzymes [BR:nmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nmul_A2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Melittin
Motif
Other DBs
NCBI-ProteinID: ABB75851
UniProt: Q2Y5X0
Position
complement(2934965..2935804)
Genome map
AA seq 279 aa AA seqDB search
MIMANILQEIVATKRQEIAALKAQGSLAVLRRQAEALPPPRDFIGALRKKLALGLPAVIA
EIKKASPSKGVLREQFDPAAIAVSYGQHGAACLSVLTDQQYFGGSAEYLKQARSACDLPV
LRKDFMLDEYQVAEARLMGADCILIIVAAFRDPFISAGSHRQQEEAVVEMRKLESLAHAL
GMAVLVEVHDGAELELALELASPLIGINNRNLHTFETRLDTTLHLLDRIPPDRMAITESG
VLTPDDVALMRGHGVGIFLVGEAFMRAPDPGTELARLFG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatggctaatattcttcaggagattgtggcgacaaagcgacaggagattgcggca
ttgaaagcgcagggttctctcgccgtgcttcgccgccaggcggaagcgttaccgccgcca
agggatttcattggggcgcttcgcaagaagctcgccctgggattaccggccgtcattgcg
gaaataaagaaggccagtcccagcaagggcgtgttgcgtgagcagttcgaccctgccgcc
atcgccgtgagctatggccagcatggcgcggcctgtctgtcggttctgacggaccagcag
tatttcggtggcagcgcggaatatctgaagcaggccagaagcgcctgcgacctgccggtc
ctgcgcaaggatttcatgctggacgaatatcaggtcgccgaggcaaggctcatgggtgcg
gattgcatcctcatcattgtcgccgccttccgcgatcctttcatttcggccgggagccac
cggcagcaggaagaagcggtagtggaaatgcgcaagctggagtcgttggctcatgcgctc
gggatggccgttctggtggaggttcatgatggggcggaactcgagctggcgctggagttg
gcgtctcccctgatcggcatcaataaccgcaacctgcatacgtttgaaacccgcctggat
acgaccctgcatctgctagaccgcattcccccagaccgtatggccatcaccgaaagcggg
gtactcacacctgacgatgttgcgctgatgcgcgggcacggggtaggcatcttcctcgtg
ggcgaagccttcatgcgggctcccgatcccgggaccgagctggcgaggttgttcgggtaa

DBGET integrated database retrieval system