KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0063Help
Entry
NMAA_0063         CDS       T01931                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase (malate dehydrogenase [acceptor]; MQO)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00020  Citrate cycle (TCA cycle)
nmw00620  Pyruvate metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
nmw01130  Biosynthesis of antibiotics
nmw01200  Carbon metabolism
Module
nmw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMAA_0063 (mqo)
   00620 Pyruvate metabolism
    NMAA_0063 (mqo)
Enzymes [BR:nmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NMAA_0063 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 MCRA
Motif
Other DBs
NCBI-ProteinID: CBY89894
Position
72690..74156
Genome map
AA seq 488 aa AA seqDB search
MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWNNAGTGHSALC
ELNYAPLGANGIIDPARALNIAEQFHVSRQFWATLVAEGKLEDNSFINAVPHMSLVMNED
HCSYLQKRYDAFKTQKLFENMEFSTDRNKISDWAPLMMRGRDENQPVAANYSAEGTDVDF
GRLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGA
GGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHL
DTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDNLYPMLRAGWANMPLTKYLLG
ELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKDSEKGGVLQFGTEIVAHADGS
LAALLGASPGASTAVPLMIRLMHQCFPERTPSWEGRLKELVPGYGIKLNENPERADEIIA
YTAKVLDI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgacagacgttgtcttggtgggcggcggcattatgagcgcgactttgggc
gttttgctcaaagaactcgaaccgtcttgggaaatcaccctgattgaacgcttggaagat
gtggcgttggaatcgtcaaacgcgtggaacaacgccggcacggggcattccgcgctgtgc
gaattgaactatgcgccgttgggtgcaaatgggattatcgatccggcgcgcgccctcaat
attgccgaacagtttcatgtcagccgccagttttgggcgacgttggtcgcggaaggcaag
ttggaagacaattccttcatcaatgccgtgccgcatatgtctttggtgatgaatgaagac
cattgttcttatcttcaaaaacgttatgacgcgtttaaaacccaaaaactttttgaaaat
atggaattttccaccgatcggaacaaaatttccgattgggctccgctgatgatgcgcggc
cgggacgaaaaccaacccgtcgccgccaactactccgccgaaggcacggatgtcgatttc
ggacggctgacgcgccaaatggtgaaatatttgcagggcaagggcgtaaaaaccgagttc
aaccgccacgtcgaagacatcaaacgcgaatccgacggcgcgtgggtgctcaaaaccgcc
gatacccgcaaccccgacgggcagctcaccctccgtacccgcttcctcttcctcggcgcg
ggcggcggcgcgctgaccctgctgcaaaaatccggcatccccgaaggcaaaggctacggt
ggctttcccgtgtccggcctgttcttccgcaacagcaaccccgaaaccgccgaacaacac
aacgccaaagtgtacgggcaggcttccgtcggcgcgccgccgatgtccgtcccgcacctc
gacacacgcaacgtggacggcaaacgccaccttatgttcggcccttacgcaggcttccgt
tccaacttcctcaagcaaggctcacttatggatttgccgctgtccatccatatggacaac
ctctatcctatgctgcgcgccggctgggcgaatatgccgctgaccaaatacctgctgggc
gaattgcgtaaaaccaaagaagaacgcttcgcctccctgctggaatactaccccgaggca
aaccccgacgactgggaactcatcaccgcagggcaacgcgttcaaatcattaaaaaagac
tccgaaaaaggcggcgtgttgcagtttggtacggagattgtcgcacacgccgacggctcg
ctcgccgcattgctgggcgcgtcgccgggcgcatcgaccgccgtgccgctgatgatccgg
ctgatgcaccaatgcttccccgaacgcaccccgtcttgggaaggccgtctgaaagagctg
gtaccgggttacggcatcaagttgaacgaaaaccccgaaagggcggatgaaattatcgcc
tataccgcgaaagtgttggatatttaa

DBGET integrated database retrieval system