KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0212Help
Entry
NMAA_0212         CDS       T01931                                 

Definition
(GenBank) putative aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00130  Ubiquinone and other terpenoid-quinone biosynthesis
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
nmw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMAA_0212
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NMAA_0212
Enzymes [BR:nmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     NMAA_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CBY90052
Position
complement(254805..255377)
Genome map
AA seq 190 aa AA seqDB search
MMVRRLIIGISGASGFQYGVKALELLRAQDIETHLVVSKGAEMARASETAYARDEVYALA
DFVHPIGNIGACIASGTFKTDGMLVAPCSMRTLASVVHGFGDNLLTRAADVVLKERRRLV
LMVRETPLNLAHLDNMKRVTEMGGVVFPPVPAMYRKPQTADDIVAHSVAHALSLFGIDTP
DSAEWQGMAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacggcgtttgataatcggcatcagtggggcgagcggtttccaatacggcgtg
aaggctttggaacttttacgcgcgcaagatatcgaaacgcaccttgtggtatcgaaaggt
gcggagatggcgcgcgcttcggaaacggcttatgcgagagacgaggtatatgccttggcg
gacttcgtgcatccgatcggcaatatcggggcgtgcattgccagcggtacgtttaaaacg
gacgggatgctggtcgccccctgttcgatgcggacgcttgcctcggtcgtgcacggcttc
ggcgacaacctcttgacgcgtgcggcggatgtggttttgaaggaaaggcggcggctggtg
ctgatggtgcgcgaaacgccgctgaaccttgcccatttggacaatatgaagcgggtaacg
gaaatgggcggcgtggtgtttccccctgttcctgcgatgtaccgcaaaccgcagacggcg
gacgacatagtggcgcacagtgttgcacacgctttgtcgctgttcggaatcgatacgccg
gattcggcggaatggcagggaatggcggattaa

DBGET integrated database retrieval system