KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0457Help
Entry
NMAA_0457         CDS       T01931                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMAA_0457
Enzymes [BR:nmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NMAA_0457
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NMAA_0457
    1.1.1.-  
     NMAA_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N Pyr_redox_2 NAD_binding_2 2-Hacid_dh_C Semialdhyde_dh 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: CBY90322
Position
complement(561205..562269)
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIHDDVPTGPGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKEGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELVSEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgataaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcactgtcggcatcaatgtcgcctggtgcggcatctgcggtactgac
ctgcacgaattcatggaaggcccgattttcattccgccttgcggtcatccgcacccgatt
tccggcgagtccgcacccgtaacgatgggacacgagttctccggcgtggtctatgccgtc
ggcgaaggcgtggacgacatcaaagtcggccaacacgtcgtggtcgaaccctacatcatc
cacgatgacgtaccgaccggcccgggcagcaactaccacctctccaaagatatgaacttt
atcggcttgggcggctgcggcggcggtctgtccgaaaaaatcgccgtcaaacgccgttgg
gtgcatccgatttccgacaaaatcccgttggatcaagccgctttgatcgaaccgctgtct
gtcggacaccacgcctatgtacgcagcggcgcgaaagaaggcgatgtcgcattggttggc
ggtgcaggcccaatcggtttgctgttggctgccgtactgaaagccaaaggcatcaaagtc
atcattaccgagttgagtaaagcacgcaaagacaaagcgcgcgaatccggcgttgccgac
tacatcctcgacccgtccgaagtcgatgtcgtcgaagaagtgaaaaaactgaccaatggc
gaaggcgtggacgtggcattcgaatgtaccagcgtgaacaaagtgttggatactttggtc
gaagcctgcaaacctgccgccaatttggttatcgtatccatctggagccaccctgcaacc
gtcaacgtccacagcgtcgtgatgaaagagctggatgtgcgcggcaccatcgcttactgc
aacgaccacgcggaaaccatcaaactggtcgaagaaggcaaaatcaacctcgagcctttc
atcacccagcgcatcaagctggacgaactggtttccgaaggcttcgagcgtctgatccac
aacaacgaatccgccgttaaaattattgtgaatccaaacctgtaa

DBGET integrated database retrieval system