KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0608Help
Entry
NMAA_0608         CDS       T01931                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase (UROS; uroporphyrinogen-III cosynthetase; hydroxymethylbilane hydrolyase [cyclizing])
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00860  Porphyrin and chlorophyll metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
Module
nmw_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMAA_0608 (hemD)
Enzymes [BR:nmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMAA_0608 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBY90480
Position
721428..722189
Genome map
AA seq 253 aa AA seqDB search
METVKPIMLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVF
WVSPTAVETAVPYLNLSDGIKMHISVGQGSRRVLERCLGRTVIAPEDGNDSEAVLRLTVW
NSLPEGARVLFVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYI
TSTELVRLLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSI
SVSDGMVFPGTSN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtgaaacccatcatgctgattgtccgaccgtcgggcagggcgaaggacgat
gtggaaacctgccgtcgtgccggatggcaggcggaagtgttgagcccgattgaaatcgaa
gcagatgctgccggactggaacttttgtccgaacaatatgcccgtgcggatgccgtgttt
tgggtcagtccgaccgccgttgaaaccgccgtcccgtaccttaacctttcagacggcata
aagatgcacatttccgtagggcagggcagccgccgcgtattggaacgctgtttgggcaga
acggtcatcgcgcctgaagacggcaacgacagcgaggcggttttgcgcctgacggtttgg
aacagtctgcccgaaggtgcgcgcgtattgtttgtgcgcggacacggcgggcgggatttt
ctgatgaatgccttgcaggagaaaggttttcggacggaggtggcagaagtctatttcaga
cggcataaacctttgaactttcaaaatttccaaaccgaaaatattgccgccgcctatatt
acgtccacagaactcgtgcgcttgctgttcggacagcttccgccgcaattttcccgattc
ttcaaatccttgctatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgtgtgttcggtcgaaaccgtccctacgctggaagccgcgctttcccattcttccatt
tccgtttcagacggcatggtctttcccggaacctcaaattaa

DBGET integrated database retrieval system