KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0836Help
Entry
NMAA_0836         CDS       T01931                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase (gamma-glutamyl kinase; GK)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00330  Arginine and proline metabolism
nmw00332  Carbapenem biosynthesis
nmw01100  Metabolic pathways
nmw01130  Biosynthesis of antibiotics
nmw01230  Biosynthesis of amino acids
Module
nmw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMAA_0836 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMAA_0836 (proB)
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMAA_0836 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CBY90726
Position
complement(965270..966379)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIATESGVPVYICSSLKPDA
LAEAADNQADGSFFVPRAKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKLRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacaccggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggctcgggttcggcaaacggcacaggcggtatgctgactaaaatcaaagcggcg
acgattgcgaccgagtccggcgtaccggtctatatctgttcctcgctcaaacccgatgca
cttgccgaagcggcagataatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagcaggggcggcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacagggaaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcctttgggcaaagggcgagtcctgttcggctctgccgccgccgaagacctgctc
aaattgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system