KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_0133Help
Entry
NMA510612_0133    CDS       T03438                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMA510612_0133 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nmx03011]
    NMA510612_0133 (rplV)
Ribosome [BR:nmx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NMA510612_0133 (rplV)
  Bacteria
    NMA510612_0133 (rplV)
  Archaea
    NMA510612_0133 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHW74460
UniProt: X5EFN7
Position
complement(115555..115884)
Genome map
AA seq 109 aa AA seqDB search
MRVNAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEH
NNGADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaatgcacaacataaaaatgcccgtatctctgctcaaaaggctcgtttggta
gctgatttgattcgtggtaaagacgttgcccaagctttgaatattttggctttcagtcct
aaaaaaggtgccgagctgattaaaaaagtattggagtcagctattgctaatgccgagcac
aataacggtgcggacattgatgaactgaaagtggtaactatctttgttgacaaaggccca
agcttgaaacgttttcaagctcgcgccaaaggtcgcggtaaccgcatcgaaaaacaaact
tgtcatatcaatgtgacagtgggtaactaa

DBGET integrated database retrieval system