KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_2054Help
Entry
NMA510612_2054    CDS       T03438                                 

Gene name
gpxA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00480  Glutathione metabolism
nmx00590  Arachidonic acid metabolism
nmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NMA510612_2054 (gpxA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NMA510612_2054 (gpxA)
Enzymes [BR:nmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMA510612_2054 (gpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AHW76328
UniProt: X5FAV4
Position
complement(1771433..1772032)
Genome map
AA seq 199 aa AA seqDB search
MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLT
PQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVN
GANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVE
RFAPSVTPEEIEADIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctttcatgccgtctgaagcacgtttcagatggcatcggtttacatcagataagg
ataaaaatgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttg
tcaggctatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgacc
ccgcaatacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagatt
ttggattttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcc
caagtgtgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaat
ggagcaaataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggc
aatcatctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaa
ggcgacatcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgag
cgttttgcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system