KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1868Help
Entry
NMBNZ0533_1868    CDS       T01949                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nmz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NMBNZ0533_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADZ04250
Position
complement(2039383..2040957)
Genome map
AA seq 524 aa AA seqDB search
MAQIQMSANVKTINAVFAAMLVGTVGYFIYWGLGYTHYNYAALFIIATMFGVFMAFNIGG
NDVANSFGTSVGAGTLTIPQALLIAAVFEVSGAVIAGGEVTNTIRKGIVDLKGVDFEPIQ
FVFIMMSALLAAALWLLFASKKGLPVSTTHSIIGGIVGSAVCMAVMNDAASGDLIRWGKL
GGIGVSWVLSPVLGGAVSYFLFSRVKKNVLDYNAWAEGTLKGIKQEKKAYKERHRLFFEG
LSEAEKVEYATKMAHDAQIYDEPEFDPQELQSEYYRGLYAFDNRKNNVDSYKALHSWIPF
IASFGAMMISAMLIFKGLKNLHLGMSNVNSFLTIFMIGAAVWMGTFVFAKSLKRKDLGKS
TFQMFSWMQVFTACGFAFSHGANDIANAIGPFAAIMDVLRTNSVAAQNVVPPIAMLTFGI
ALIVGLWFVGKEVIKTVGTSLAEMHPASGFTAELSAASVVMGASLMGLPVSSTHILVGAV
LGIGLVNRNANWKLMKPIGLAWVITLPAAAVLSVVCYLVLQAVF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatccaaatgagcgcaaatgttaaaaccatcaacgccgtctttgccgccatg
ctggtaggtacagtcggctattttatttattggggcttgggttatacccattacaattac
gccgccttattcattattgccacgatgttcggcgtgtttatggcgttcaacatcggcggc
aacgatgttgccaattctttcggcaccagcgtcggtgcgggtacgctgaccatcccgcag
gctttgctgattgcggcggtatttgaggtcagcggcgcggtcatcgcgggcggtgaggta
accaataccatacgcaaaggcatcgtcgatttgaagggtgttgatttcgaacccatacag
tttgtgtttattatgatgtccgcgcttttggcggcggcgttgtggctgttgtttgcctcg
aaaaaagggcttccggtatctaccacccattccattatcggcggcattgtcggcagcgcg
gtatgtatggcggtaatgaacgatgccgcatcgggcgatttgatacgttggggcaagctg
ggcggtattggtgtttcttgggtattgtcgcccgtgttgggcggcgcggtgtcctatttc
ctgttttcgcgcgtcaagaaaaacgtcttagattacaacgcttgggcggaaggcacgctc
aagggcatcaagcaggaaaaaaaggcctataaagaacggcaccgcctgtttttcgagggt
ttgtccgaagccgaaaaagtcgagtacgccaccaaaatggcgcacgacgcgcaaatttac
gacgaacccgaattcgatccgcaagagctgcaatcggagtattaccgcggtctttatgcg
ttcgacaaccgtaaaaacaatgtcgattcctacaaagcgctgcattcttggattcccttt
atcgcttcgttcggcgcgatgatgatttccgctatgctgattttcaagggcttgaaaaac
ctgcatttggggatgagcaacgtcaacagcttcctgaccatctttatgataggcgcggcg
gtgtggatggggacgtttgtttttgccaaaagcctcaagcgtaaagacttgggcaaatcg
acctttcagatgttttcatggatgcaggtctttaccgcctgcggcttcgcattcagccac
ggggcgaacgatatcgccaacgccatcggtccgtttgccgcgattatggatgttttgcgt
accaacagcgttgccgcgcaaaatgtcgtccccccgattgcgatgctgactttcggtatc
gcgctgattgtcggtttgtggtttgtcggtaaagaggtgattaaaaccgtcggtacgagt
ttggcggaaatgcaccccgcctcgggttttactgccgaactgtccgccgcatctgtcgtg
atgggcgcgtcgctgatggggctgcccgtgtccagtacgcatatcttggtcggcgcggta
ctcggtatcggtctggtcaaccgtaatgccaattggaaactgatgaagcccatcggtttg
gcgtgggtcattaccctgcctgccgccgccgtattgtcggttgtctgctacttggtttta
caggcagtattctga

DBGET integrated database retrieval system