KEGG   Nipponia nippon (crested ibis): 104008615Help
Entry
104008615         CDS       T05756                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00140  Steroid hormone biosynthesis
nni01100  Metabolic pathways
Module
nni_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
nni_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    104008615
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     104008615
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     104008615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_4 Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind NmrA KR Sacchrp_dh_NADP DUF5406
Motif
Other DBs
NCBI-GeneID: 104008615
NCBI-ProteinID: XP_009458787
Position
Unknown
AA seq 377 aa AA seqDB search
MSLAGVSCLVTGAGGFLGQRIVGLLLEEKEALAEIRLLDKAFSSEALGRFGKFQGKTEVK
ILEGDIRDATFLHRACQGVSLVIHTASIIDTLGLIDKQLLWEVNVTGTQLLLEACVRCNV
QHFIYTSTIEVTGPNCKGDPVFNGDEDTAYESVSKSPYAQSKRLAEDSVLKADGQVLKDG
GMLMTCALRSMYIFGEGCPFLQGHLDKCLLNKNVYLRFSRKEALVNPVYVGNIAWAHVQA
AKALQVPQKAKHIRGQFYYISDDTPHMSYADLNYELTRELGFGIEPRLPMPLKMLYYFSL
LLEIVSFLLRPFVRYIPSTNRHLVTLLNTPFTFSYRKAQKDFGYMPRYTWEEAKQRTAQW
IASMVPQRREYLKSKAA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggctggggtaagctgtctggtgacaggagcaggaggatttcttggccagaga
attgtcggcttgctgttggaagaaaaggaggcgctggctgagatccgactgctggacaaa
gcctttagcagtgaagcactcgggagatttggaaagttccagggtaagactgaggtgaaa
atcctggaaggggacattcgagacgcgacgttcctgcaccgtgcctgccagggggtctcc
ctcgtcatccacacggcttccatcatcgacaccttgggcctcatcgacaagcagttgctc
tgggaagtcaacgtaacaggcactcaactgctgctggaggcatgcgtccgctgtaacgtc
cagcacttcatatataccagtaccatagaagtgacaggcccaaactgcaaaggcgaccca
gttttcaacggtgatgaagatacagcttatgagagtgtatcaaaatctccttacgcccag
agtaagagactggcagaggattctgtgctgaaagcagatggccaggtgttaaaggatggt
ggcatgctgatgacttgtgccctaagatccatgtacatttttggagaaggatgcccattt
cttcaaggtcatctggacaagtgtctgttgaacaaaaatgtctacctgcgcttctccagg
aaggaggctttggtgaaccccgtctatgtggggaatatcgcctgggcacatgtacaggca
gccaaagccctgcaggtcccacagaaagccaagcacatcagggggcagttctactacatc
tcagatgacactcctcatatgagctatgcagatctaaactacgagctgaccagggagctg
gggtttggaatcgagccccggctccccatgcctctgaaaatgttgtattacttctcgctg
ctgctggagatcgtgagcttcttgctcaggcccttcgtcagatacatcccctccaccaac
cgtcacctggtcacgctactgaacaccccattcaccttctcttatagaaaagcacagaag
gattttggctacatgccccgctacacatgggaagaggccaagcagcgcactgctcagtgg
attgcctccatggtcccacagagaagggagtacttgaaaagcaaggctgcctaa

DBGET integrated database retrieval system