KEGG   Nipponia nippon (crested ibis): 104010145
Entry
104010145         CDS       T05756                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104010145 (AKAP5)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     104010145 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 104010145
NCBI-ProteinID: XP_009460494
Position
Unknown
AA seq 463 aa
MAKAAKEIQMENPREVDTHSTGATCSPSEEQAEKPSMLCFKKRKKPCKKGLATKDACEGA
SEEKSQCASADQGEAKVSNQSRSSKGAWAAIKNLARPRRRQKSSSWKKAPSSSQVQLEVD
VEEGCAQGFPKKRASSGVKMPCVRFSRGKKKASPSEAVEESEGSVQANEVMGISNKASEE
PEDLAPTDKSESFSPVSAEEDQDAAKESTDSVAKSEPVTEPAPDVEEQMERTAQSEGTDS
EPVDETAQEKLQEGSLPQATEHAEGKDVAPEAPVSKDQSDSAPETTEPQEITNICEELPE
GDESGKSINLPEESKAEETAMDFSPSAFKDDAASVQGCSSHQVTLEASAGVGIVITVTEA
EDSEDTDSDQAYEPSPVLHQNKQKGNKKSSGSFDFGKKEGPEAGGGPQAEEKGPGEQGHR
TGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcgaaggcagctaaggaaattcaaatggagaacccaagagaggtagatactcacagc
acaggggcgacgtgctccccgtcggaggaacaggcagaaaaaccctccatgctctgtttc
aagaagcggaagaagccctgtaagaaggggctggccacgaaggatgcatgcgaaggagcc
tcggaggagaaaagccaatgcgccagcgctgaccaaggcgaggcgaaagtttctaatcaa
tcgcgatcctccaaaggagcctgggcagccatcaaaaacctcgcaagacctcggagaagg
cagaaatcctcctcgtggaagaaggcgccctccagttcccaagtgcagctggaggtggac
gttgaggagggctgtgcgcaaggcttcccgaaaaaacgggcgagctctggggtgaagatg
ccctgcgtgcggttctccagaggcaagaaaaaagccagcccctctgaagcagtggaggag
tcggagggcagcgttcaagcaaatgaagtgatgggcatttcgaataaagctagtgaagag
ccggaggatttggccccgacggacaagtcagaatccttcagcccggtctctgcagaggag
gaccaggatgcggcgaaggaaagcaccgactctgttgcgaagagcgagcccgtgacagag
cccgcacctgacgtggaggagcagatggagcgcaccgctcagtcagaggggaccgattcg
gagcctgttgatgaaacagcccaggaaaaactgcaggaggggagcctaccccaagccaca
gaacatgcggaaggcaaggatgttgctcccgaagctcccgtttccaaggatcaatccgac
agcgcccctgaaaccaccgagccgcaggaaatcaccaatatctgcgaagagctgcctgaa
ggggatgaatcaggaaagagcataaatcttcctgaggagagcaaagccgaagagactgca
atggatttcagtccatcggcgtttaaagatgacgcagcgagcgtgcagggctgctccagc
catcaggtgacattggaagcaagcgcaggcgtcggcattgtcatcactgtcaccgaagcc
gaggactctgaggacaccgactctgaccaggcctacgagccgtccccggttttgcaccaa
aataagcaaaaagggaacaaaaaatcaagtgggagctttgattttggtaaaaaagagggc
cctgaggctggcggcggtccccaggccgaggagaaaggtccgggcgagcaggggcacaga
actggggagcagtacgaattgctcctcatagaaactgcatcttccctcgtgaaggcggcc
attcagtcgtccatagagcagctggtcaatgaaatggccctggaacagaataaacacaac
agttttctgtga

DBGET integrated database retrieval system