KEGG   Nipponia nippon (crested ibis): 104011855Help
Entry
104011855         CDS       T05756                                 

Gene name
IL4I1
Definition
(RefSeq) L-amino-acid oxidase
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00250  Alanine, aspartate and glutamate metabolism
nni00270  Cysteine and methionine metabolism
nni00280  Valine, leucine and isoleucine degradation
nni00350  Tyrosine metabolism
nni00360  Phenylalanine metabolism
nni00380  Tryptophan metabolism
nni00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nni01100  Metabolic pathways
Module
nni_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104011855 (IL4I1)
   00270 Cysteine and methionine metabolism
    104011855 (IL4I1)
   00280 Valine, leucine and isoleucine degradation
    104011855 (IL4I1)
   00350 Tyrosine metabolism
    104011855 (IL4I1)
   00360 Phenylalanine metabolism
    104011855 (IL4I1)
   00380 Tryptophan metabolism
    104011855 (IL4I1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    104011855 (IL4I1)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     104011855 (IL4I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 AlaDh_PNT_C DAO Pyr_redox FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 FAD_oxidored RRM_3 Pyr_redox_3 MCRA 3HCDH_N GIDA FMO-like Trp_halogenase TrkA_N ApbA
Motif
Other DBs
NCBI-GeneID: 104011855
NCBI-ProteinID: XP_009462431
Position
Unknown
AA seq 542 aa AA seqDB search
MLIDECLHYIIFFSFLLSLVLFQILLLVGLLSAKKFPCFPEYCLHDKDYEELLEIVKNGL
EPAIHPANVVVVGAGISGLTAAKLLRDAGHTVTILETSNQVGGRIKTYRPEGQDWYVELG
AMRLPSKHRLVREFIRQFDLKLNPFIQTDDNTWYFLNGTRIRAVEVNRNPNILNYTVKPS
ERGKSASQLYREALNKAFDTFQTTDCKKFLAKHDSFSTKEYLIKVGNLSRGAVQMIGDLL
NEDSGFYLSFLASLWDFDVFSNESFDEITGGFDQLPKAFHEALPDVIQFNCTVEKIMTKG
NKVHVFYRAPDTLAPSTVTADYVLVTSTAKATRHIRFLPPLSPPKAHALRSIHYASSSKI
VLACSEKFWEKDGIRGGQSITDRPSRFIYYPSHNFSSGVGVILASYTWNDDAEFFLPLTD
EKCLDVVLQDLSDIHQVSKEYLQYTCDQYVIQKWQLDKHSLGAFAAFTPYQFVDYSQALF
EHEGRVHFAGEHAAQPHAWIDTAMKSAIRAASNIHHASSEAQMLNEEEEEEQRRSFLQKE
DL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgacgagtgccttcattacattattttcttctcttttcttctctccctagtc
ctcttccaaatactcctgctcgtaggtctcctaagtgcaaagaagtttccatgtttccct
gaatattgccttcatgacaaagactacgaggagctgctggagattgtcaaaaatgggcta
gaacctgcaattcatccagcaaatgtggtcgttgtcggtgcaggaataagcgggcttaca
gcagcgaagttgctccgagatgccggccacacggttactattctggaaacaagcaatcag
gtgggtgggcggatcaagacataccgaccagagggacaggactggtatgtggagttggga
gccatgcgcctgccgagcaagcacaggctcgtccgtgaattcattaggcagtttgacctg
aagctaaacccattcatccagacagatgacaacacctggtactttttgaacggcactcgg
ataagagctgtggaagtgaatagaaaccccaatatcctaaactacacagtgaaaccatca
gagagaggcaagagtgccagccagctttatagagaagcactaaacaaggctttcgacacg
ttccagactacagactgcaagaaatttctagctaagcacgactccttctccaccaaggag
tatttgattaaagtaggaaatctaagccgaggagcagttcagatgatcggtgacttgttg
aacgaggactccggattttatctgtccttccttgcctcgctgtgggattttgatgtcttc
tctaacgagagttttgatgaaatcacagggggatttgaccaactgcccaaagccttccac
gaagcgttgcccgatgtcatccaattcaattgcacggtggagaaaatcatgaccaaggga
aacaaagtccatgtgttttaccgcgctccggacactctggctccaagcacagtaactgca
gattacgtccttgtcacatctaccgccaaagccaccaggcacatccgattcctgccaccg
ctctctcctccgaaggcccacgccctgcgctccattcactacgcaagctcctccaaaata
gtcttggcttgctccgagaagttctgggagaaggacggcatcagaggagggcagtccatc
actgaccgcccttcacggtttatctactatcccagccacaacttctccagcggggtgggt
gtgatcctggcttcctacacctggaacgatgatgctgagtttttcctgcctctcacagat
gagaagtgcctggatgtggtcctccaagacctgtcagatatccaccaagtgagcaaggag
tacctgcagtacacctgcgaccagtacgtgatacagaagtggcaactggacaaacactcc
ctgggggcatttgctgccttcaccccttaccagttcgttgactactcgcaggctctcttc
gagcatgagggcagggtgcattttgcaggagaacacgcagctcagcctcacgcctggatc
gacaccgccatgaaatcagccatcagggctgcgagcaacatccaccatgccagcagtgaa
gcccagatgctgaacgaggaggaggaggaggagcagagaaggagcttcttgcagaaggaa
gatctctga

DBGET integrated database retrieval system