KEGG   Nipponia nippon (crested ibis): 104012113Help
Entry
104012113         CDS       T05756                                 

Gene name
ZDHHC3
Definition
(RefSeq) palmitoyltransferase ZDHHC3 isoform X1
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104012113 (ZDHHC3)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104012113 (ZDHHC3)
Membrane trafficking [BR:nni04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    104012113 (ZDHHC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF3615
Motif
Other DBs
NCBI-GeneID: 104012113
NCBI-ProteinID: XP_009462737
Position
Unknown
AA seq 327 aa AA seqDB search
MMITPVHRFRDIERKPEYLQPEKCVPPPSRASLGTMWFIRDGCGIACAVVTWMLVFYADF
VVLLVMLVPSRDYVYSVINGTLFNTLAFLALASHFRAMLTDPGAVPKGNATKEFIESLQL
KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIA
LISLHALIMVGFHFLYCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTSVMFGTQVH
SICTDETGIERLKKQKPTWERISGWEGMKLAFGGAFSLGWFNPFSDLNCESPAPAEAAAA
APASAIMTQEEIEQFLARDVAIQVLHE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgattactccagtccaccgcttcagagatattgaaaggaaacctgaatacctccag
ccagaaaagtgtgttccacctcctagccgcgcttccctgggaacaatgtggtttattcga
gatggctgtggtattgcatgtgctgtcgttacctggatgctggtgttctatgccgacttt
gtagtccttcttgtcatgctagttccatcgagagattatgtttatagtgtcatcaatggc
acactgttcaacaccttggctttcctcgctttggcttcacattttcgtgctatgctgaca
gatccaggtgctgtacccaaaggtaatgccacaaaggagttcattgagagtttacagcta
aagccaggacaagtagtttacaagtgcccaaagtgttgtagcatcaaacctgacagagca
catcactgcagtgtttgcaagaggtgtattcggaaaatggaccatcactgcccgtgggtc
aataactgtgtaggagagaataaccagaagtactttgtactgtttacaatgtatatagca
ctgatttccctgcatgctctaatcatggtgggatttcacttcttgtattgcttcgaagaa
gactggacaaaatgcagttccttctctccgccaactacagtgattcttctcatcctcttg
tgttttgaggctctcctatttctcatcttcacctcagttatgtttgggacccaagtacac
tccatctgcactgatgaaacgggtattgagcgtcttaaaaaacagaagccaacctgggag
aggatcagcggctgggaaggaatgaagctggcgtttggtggtgctttctccttgggttgg
ttcaatcccttttcagacctgaactgcgagagcccggcgccggccgaagcggcggcggca
gctcctgcgtctgcaataatgacccaagaagaaatcgagcagtttctcgctcgagatgtt
gccatccaagtgttacatgaataa

DBGET integrated database retrieval system