KEGG   Nipponia nippon (crested ibis): 104012429Help
Entry
104012429         CDS       T05756                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104012429 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104012429 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104012429 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104012429 (MTMR4)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     104012429 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104012429 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104012429 (MTMR4)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104012429 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 104012429
NCBI-ProteinID: XP_009463079
Position
Unknown
AA seq 1160 aa AA seqDB search
MSLPGRVSCSMLNCFGEEGPPSLEYIQAKDLFPPKELVKEEESLQVPFTVLQGEGVEYLG
HANDAVIAISNYRLHIKFKDSVINVPLRMMESVECRDMFQLHIVCKDSKVIRCHFSTFKQ
CQEWLKRLTRAIARPAKPEDLFAFAYHAWCLGVCVDEEDQHAHLCRPGDHVRYRFEMELV
RMGFDLQNVWRVSDINNNYKLCSSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHV
RNGAVIARCSQPEISWWGWRNADDEYLVTSIAKACALNPGVKASGGVPHNGSSDGSEACD
TDFDSSLTACSGVENAGTPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMA
NIHSIRNSFQYLRAVCSQVPDPSNWLSALESTKWLQHLSVMLKAAVLVSSAVDREGRPVL
VHCSDGWDRTPQIVALAKILLDPYYRTMEGFQVLVESDWLDFGHKFGDRCGHQEKVEDQN
EQCPVFLQWLDAVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLGNSPCEREMHNIY
KRTCSVWSLLRAGNKNFHNLLYMPGSEQVLHPVCHVRALHVWTAVYLPASSPHPLGQDDM
DIYLPPGSQSQEFSGRCLDRLPKTRSMDDLLSACDSSSPLTRTSSDPNLNNHCQEVRVGL
EARHAAAEGAELHLGESSAVAAGETRQADEQEEDAPLQANSACSSRAEHEGQSKQLSSWA
SVPGSSVALEAEKGNGTYTEELDGTCPAPDPSGQENVDRVSTGSGKQLETDPQEPLKATG
MVANGGGCPKRNTTCQDIPSQESLGPSAPCQDIPGPAPGTPCLDEDNGKGDAGRSVPCEE
PGRLGRVPLEQWRKPISQSQSSEFSFLGSNWDSFQGMVTSLPNGEPAPRHLPSYGCCSKR
LSSKALRAPGLCLSGQWSAREGAKPSGCSGHVGTHFAGPAGKPGRSWLPCHLKQASGPKH
VPPKCPSPVPPLYLDDDGLPFPTDVIQHRLRQIEASYKQEVEQLRRQVRELQLRLDIRHF
CAPPAEPPMDYEDDFTCLKESDGSDTEDFCSDHSEDCLSEASWEPVDKKETEVTRWVPDH
MASHCFNCDCEFWLAKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYDHIQV
SRARELMSQHLKKPIATASS
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgccaggccgcgtctcctgctccatgctcaactgctttggtgaggaaggccct
cccagtttggagtatatccaggccaaggacttgttccccccgaaagagctggtaaaggag
gaagagtcattgcaggtcccattcactgtgttgcagggcgagggagtggagtatcttggt
catgcaaacgatgctgtgatcgccatctccaactaccggcttcatatcaaattcaaggat
tctgtgatcaatgtgcctttgaggatgatggaaagtgtggagtgtcgggatatgttccag
cttcacatcgtctgcaaggactccaaagtgatcaggtgccatttttccacctttaagcag
tgccaggagtggctaaagaggctaactcgagccatcgcccgccctgcgaagcctgaggac
ctctttgcatttgcgtaccatgcgtggtgcttaggagtctgtgttgatgaggaggatcaa
catgcacatctctgccgtccgggagaccatgtgagataccgatttgagatggagctggtg
aggatgggctttgacttgcagaacgtctggcgcgtctctgacatcaacaacaattacaag
ctttgttccagttatccccagaagctgctggtccctgtctggatcaccgataaggagcta
gagaatgtggcttcgtttagatcgtggaaaaggatccctgtggtggtgtacagacatgtg
cgcaacggggcggtgatcgcacgctgcagccagcctgaaatcagctggtggggctggcga
aatgctgacgacgagtatcttgtgacatctattgccaaagcctgtgccttgaaccctgga
gtaaaggcatccggtggcgtgccgcacaacgggagcagcgacggcagcgaggcctgcgat
accgacttcgactcgtccctgaccgcgtgttcaggcgtggagaacgcaggaactcctcag
aagctgctgattcttgatgccaggtcctacacggcggctgtggccaacagagcgaaggga
ggcggctgcgaatgtgaagagtattacccaaactgtgaagtcgtgttcatgggaatggcc
aacatccactccatccggaacagtttccagtatctgcgtgctgtctgcagtcaggtgcca
gaccccagcaactggctttcagccctagagagtaccaagtggctgcagcacctttctgtc
atgctgaaggcagcagtgctggtctccagtgcggttgacagagaagggcgtccagtgctg
gttcattgctcagacggctgggacaggactccgcagattgtagcactggcaaagattctt
ctggacccttactacaggaccatggagggcttccaggtgcttgttgaatcggattggctg
gattttggtcacaagtttggtgatcgctgcggtcatcaggagaaggtggaagatcagaac
gagcagtgcccagtttttctccagtggctggatgctgttcatcagcttctgaagcaattt
ccttgcctctttgaatttaacgaagcttttttggtgaagctggtgcagcacacgtattcc
tgcctctatgggaccttccttgggaacagcccctgcgagcgagagatgcacaacatctac
aagcgtacctgctccgtctggtccctcctgcgggctggcaataagaacttccacaatctt
ctttatatgccagggtccgagcaggtgctgcatccagtgtgccacgtgcgagcgctgcac
gtctggacagcggtgtatctcccggcttcctcgccacatcccctgggacaggatgatatg
gacatttacctgccccctggatctcagagccaggagttcagcggcagatgtttggacaga
ttaccaaagacaagatctatggatgacctgctctccgcctgcgactccagcagcccactg
acccgcacgtctagcgatccgaacctgaataaccactgtcaggaagtccgggtgggcctg
gaagcccggcatgccgctgctgagggagccgagctgcacttgggtgaaagcagcgcggtg
gccgcaggagagacgcggcaggcggacgagcaagaggaagacgctcccctgcaagccaac
agcgcttgtagcagccgtgctgagcacgaagggcagagcaagcaactgagcagctgggct
tctgtgccaggaagcagtgtcgctctggaggcagaaaagggaaatggaacatacacggag
gaactggatggcacgtgtccagctccagatccttccggacaggaaaatgttgacagggtt
tccaccggttctggcaagcagctagaaaccgatccacaggaacctttgaaggctactggc
atggtggccaacggaggaggctgccccaagagaaacaccacctgccaagacattcccagc
caggagtccctgggaccaagcgccccgtgtcaggacatcccaggccctgccccgggcacc
ccctgcctggatgaagataacggcaaaggcgatgctggaaggagtgtgccctgcgaggag
cctggccggctggggagagtcccgctagagcaatggcgcaagcccatttcccagagccaa
agcagcgagttctccttcctggggtccaactgggacagttttcaaggaatggtgacatcg
ctccccaatggggagcccgcacccaggcacctcccctcctacggctgctgtagcaagagg
ttgagcagcaaagctctgcgggcaccaggcctgtgcctcagtggccagtggtctgccaga
gaaggtgcgaaaccctcaggctgctctggccacgtcggcacgcattttgcgggccctgca
gggaagcctggccgctcgtggctaccctgccacctgaaacaagcgtctggtcccaagcac
gtgccaccaaaatgtccttctcctgtgcctcctctctacctggatgatgacgggctcccc
ttccccacggacgtgattcagcacaggctgcggcagatcgaggccagctacaagcaggag
gtggagcagctgcgcaggcaggtacgagagctgcagctgcgcctggacatccgccacttc
tgcgcccctccggccgagcctccgatggactacgaggatgactttacatgtctgaaggaa
tcggacggcagcgacactgaggatttctgttccgatcatagcgaagactgtttgtcagaa
gcgagctgggagcctgttgataagaaggagactgaggtcacgcggtgggttccagaccac
atggcctcgcattgttttaactgcgattgtgaattctggctggccaaacggaggcatcac
tgcaggaactgtgggaacgtgttttgtgctggttgctgccacctgaagttgcccatccct
gaccagcagctgtacgaccctgtcctcgtttgtaactcctgttatgaccacatccaagtg
tctcgtgccagggagctcatgagccaacatctgaagaaacccatcgccacagcttccagc
tga

DBGET integrated database retrieval system