KEGG   Nipponia nippon (crested ibis): 104014389Help
Entry
104014389         CDS       T05756                                 

Gene name
DCXR
Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00040  Pentose and glucuronate interconversions
nni01100  Metabolic pathways
Module
nni_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104014389 (DCXR)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     104014389 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1776
Motif
Other DBs
NCBI-GeneID: 104014389
NCBI-ProteinID: XP_009465302
Position
Unknown
AA seq 261 aa AA seqDB search
MINGWNVDLAKVSDFGPAVLGCTVDFSELLNFLPFVKRYNVGKRLQCIQVLVFNLLQQKA
VKLHELLCPGIQPLCLDLADWDATGAAGGAAGPFDLLVNNAAVAVLQPFLEVTRAALERS
LDVNLGAVLHVSQIVARQMIAQGVPGAIVNVSSQASQRALRDHAVYCSTKSALDMLSKVM
AMELGPHKIRVNTVNPTVVMTDMGRINWSDPQKSAAMINRIPLGKFAEVDDVVNXXXXLL
SDKSAMTTGSSLMVDGGFLVS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgattaacggctggaatgtggacctagcaaaagtttcagatttcggcccagctgtgctg
ggctgtactgtggacttcagcgagttgcttaacttcctgccctttgtaaagcggtataat
gtgggcaaacgcctgcagtgtattcaagttcttgttttcaacctcctgcagcagaaggct
gtgaaacttcacgagctcttgtgccctggcatccagcccctctgcctggacctggccgac
tgggacgccacgggggcggcggggggggcggcggggcccttcgatctgctggtgaacaac
gcggccgtggcggtgctgcagcccttcctggaggtgacgcgggcggccctggagcggtct
cttgatgtgaatctcggggctgtgcttcatgtttcccagattgttgctcggcagatgatt
gctcagggggtgccaggtgctattgtgaacgtctccagccaggcatctcagcgtgctctg
cgggaccatgccgtttactgttccaccaaaagtgctttggatatgctgagcaaggtaatg
gcaatggaactgggaccccacaagattagggtaaacactgtgaaccccacagtggttatg
accgacatggggagaattaactggagcgaccctcagaaatctgctgccatgattaatcgg
attccgctgggcaagtttgcagaggtggatgatgtggtgaacnnnnnnnnnnnnctgctg
agtgataagagtgctatgacaactggcagctcactgatggttgatgggggatttcttgtc
tcctaa

DBGET integrated database retrieval system