KEGG   Nipponia nippon (crested ibis): 104014633Help
Entry
104014633         CDS       T05756                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104014633 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104014633 (CAMK1D)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104014633 (CAMK1D)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   104014633 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal RIO1 APH 5_nucleotid Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 104014633
NCBI-ProteinID: XP_009465570
Position
Unknown
AA seq 373 aa AA seqDB search
MVLGLGKAFAKVFTLDSPYGFNQPQTDTWQTGKLNRGAFSEVVLAEERASGKLFAVKCIP
KKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGF
YTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKG
DVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILK
AEYEFDSPYWDDISESAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSA
QIRKNFAKSKWRQAFNATAVVRHMRRLHLGSSLDSASASVSSTLSLAAPLPDAATRKDSL
IVDFYLQSHRGHL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttggccttgggaaagcatttgccaaggtcttcaccttggattcaccctatggc
ttcaatcaacctcagacagacacatggcaaacagggaagttgaacaggggtgcattctcc
gaagttgttttggctgaagagagagcgagtgggaaactctttgccgtcaagtgcatcccc
aagaaggcactgaagggaaaggaaagcagcatagagaatgaaattgcagttctgagaaag
atcaagcatgaaaatatagttgccctggaagacatctatgagagtccgaaccatttatat
ctggtcatgcaattagtgtctgggggagagctttttgaccgcatcgtcgagaaagggttc
tacactgagaaggatgccagcaccctgatccggcaggtcctggatgctgtctactacctg
caccgaatgggcatcgtgcacagggacctcaagcccgagaacctgctttactacagccag
gatgaagagtcaaaaatcatgatcagtgacttcggattgtcaaagatggagggtaaagga
gatgtgatgtccacagcctgtgggactcctggctatgttgctcctgaagtgctggcccag
aaaccttacagcaaagctgtggactgctggtccattggggtcatcgcgtacatcctgctc
tgtgggtatccccctttctatgatgaaaatgactccaaactctttgagcagatccttaag
gcagagtatgagtttgactctccatattgggatgacatctctgagtctgctaaagacttc
attcggaatttgatggagaaggaccctaataaaagatacacctgtgagcaagcggcgcgg
cacccttggatcgctggtgatacagcactcaacaaaaacatccacgagtctgtcagcgct
cagatccggaagaactttgcaaaaagcaaatggagacaagcgtttaatgcgacagcggtc
gtgcgacacatgagacggttacaccttggcagcagcctggacagcgcaagtgccagcgtg
tcgagcaccctcagcctcgccgcgccgcttcccgacgcagccacacggaaagattctttg
attgttgatttttacctccagagtcacagaggccatctctga

DBGET integrated database retrieval system