KEGG   Nipponia nippon (crested ibis): 104015846
Entry
104015846         CDS       T05756                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nni01002]
    104015846 (ERAP1)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     104015846 (ERAP1)
Peptidases and inhibitors [BR:nni01002]
 Metallo peptidases
  Family M1
   104015846 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 104015846
NCBI-ProteinID: XP_009466911
Position
Unknown
AA seq 768 aa
VLAATQFEPTAARMAFPCFDEPAFKARFSIKIRREPKHLALSNMPIVKSVNITPWLVEDH
FDTTVKMSTYLVAFIVSDFKSISKTTGHGVKISVYTVPDKINQADYALDAAVKLLDFYED
YFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDPEKSSASSKLRITMIIAHEL
AHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSITHPELRVEDFFLSKCFDAMSVDALNS
SHPISTPVEDPAQILEMFDEVSYEKGSCVLNMLRDYLTADVFKAGLVQYLQKYSYQNTKN
EDLWNSMTDICPTVGSDKNERQGDGFCRRSQQSSSNAHWTKGETLDVRAMMDTWTLQKGF
PMVTVTVRGKNVHLQQERYVKGVDSPSSTGYLWHIPLTYITSKSDAVQRFLMTTKADVII
LPEEVEWVKFNVDMNGYYIVHYEDDGWDRLINLLKENHTVISSNDRASLINNVFQLVRVK
KLSISKAFDLTLYLKHEREIMPVLQGMTELIPIYRLMERRDTDGTEKQLKEYIVHLFREL
IDEQSWSDEGSVSERLLRHSLLLFACVHRYQPCVDKAKAYFTEWQKSNGTLRLPADVKTA
VYTVGAQTSEGWDFLLGKYRLLSFNVERENIELALAFSRSKDKLQWLMDQGLRGDIVRTQ
DLPFIIVYVAKNPSGYHLAWTFLKENWEKVVEKFELGSNSIATIVTGVTSRYSTRSQLAQ
VKEFFSSLEEKSTRLHCVQQAIETIEDNIQWMDRNLEKVKTWLQNNYL
NT seq 2308 nt   +upstreamnt  +downstreamnt
agtgcttgcagcaacacagtttgagccaacagctgcgcggatggccttcccatgttttga
cgaaccagccttcaaagccaggttttcaattaagattaggagggaaccaaagcaccttgc
gctgtccaatatgccaattgtgaagtctgtgaatataaccccctggcttgttgaggacca
ttttgataccactgtcaagatgagtacgtaccttgtggcctttatcgtttcggattttaa
atccatcagcaaaacaacaggtcatggagttaagatttctgtgtacacagtgccagacaa
gatcaaccaagctgattatgcattggatgcggcagtgaaacttttagacttctatgagga
ttacttcagcattccatatcctttacctaaacaagatttagcagctattcctgattttca
gtctggtgctatggaaaactggggactgaccacataccgggaatctgcattgctgtatga
ccctgaaaagtcctcagcatcttctaaacttcggattactatgataatagcccatgaact
ggctcatcagtggtttggcaaccttgttaccatggagtggtggaatgatctgtggttaaa
tgaagggtttgcaaagtttatggagttcgtgtcagtcagcattacccatccagaactgag
agttgaagactttttcttaagtaaatgttttgatgccatgtcagtggatgcattaaattc
atcacatcctatatccactcctgtggaagatccagctcaaattttagaaatgtttgatga
agtttcttatgagaagggatcttgtgtattaaatatgctgagggactacctgactgctga
tgtgtttaaagctggacttgtccagtacctgcagaaatacagctatcagaatacaaaaaa
tgaagacttgtggaacagcatgacagatatttgccctacagtaggtagtgataaaaatga
acgacaaggtgatggtttttgcagaagaagccaacagtcatcttcaaatgcacactggac
taaaggagagactcttgatgtgagggcaatgatggacacttggacactgcaaaaaggttt
tcccatggtaactgtcacggtgagagggaagaatgtccacctgcagcaggagcgctatgt
gaagggagtagattctccttcatccacagggtacttgtggcacattccactaacctacat
taccagtaaatcggatgcagttcagagatttttgatgacaactaaagcagatgtcattat
ccttccggaagaggtggagtgggttaaattcaatgtggacatgaatgggtattacattgt
gcactatgaagacgatggatgggatcgtctgattaaccttttgaaagagaaccatacagt
gattagcagcaatgacagagcaagtctcattaataatgtattccagcttgtgagggtaaa
aaaattgtcaatttccaaagcttttgatttaactttgtacctgaaacatgaaagagaaat
catgcctgtactccaaggtatgactgagctgattcctatatacaggctcatggagaggag
ggatacagatggtacagaaaaacagttaaaggagtatatagtgcatctatttagagagct
gattgacgagcagtcttggagtgatgaaggctcagtgtctgagagattgcttaggcactc
gcttctgctgtttgcgtgcgtgcataggtaccagccatgcgtggacaaagccaaagcata
ttttacagaatggcagaaatccaatggaaccttgagattgccagcagatgtgaagacagc
agtgtacactgttggagcacaaacatccgaaggctgggatttccttcttggtaaatacag
actgctctcattcaatgtagagagagagaacattgaattagctctcgccttcagcagaag
taaggacaaacttcaatggttaatggatcaaggtctgcgtggtgacatcgtaagaactca
ggatcttccatttattattgtatatgttgccaaaaacccatctggctatcatctagcgtg
gacgtttttaaaagaaaattgggagaaagttgtagaaaaatttgaacttggttcgaattc
catagcaaccattgtcactggagtgacaagtcggtactcgacaaggtcacagcttgcaca
ggtgaaagaattcttcagttctctggaggaaaaaagcacacggcttcactgtgtccagca
agctattgaaaccattgaagacaatatacaatggatggatagaaatctggagaaagtcaa
aacttggttgcaaaacaactatctgtaa

DBGET integrated database retrieval system