KEGG   Nipponia nippon (crested ibis): 104016464Help
Entry
104016464         CDS       T05756                                 

Gene name
PLA2G15
Definition
(RefSeq) group XV phospholipase A2
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00564  Glycerophospholipid metabolism
nni04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104016464 (PLA2G15)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104016464 (PLA2G15)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     104016464 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT DUF915 Abhydrolase_6 Hydrolase_4 PGAP1 DUF900
Motif
Other DBs
NCBI-GeneID: 104016464
NCBI-ProteinID: XP_009467633
Position
Unknown
AA seq 476 aa AA seqDB search
MPSLSLTSSPPSRPTPPSSYTERDVIRNLHDHTAVDGVTWDERTPAAARLPPDVRTASRD
HRPLARTCGAPYLSALPHTGRARPAAAGGPRKFCNKCFSESVSRGPVPGDLGNQLEAKLD
KPSVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSKTTEPPDGVDIRVP
GFGQTFSLEFLDPSKRSVGSYFYMLVQSLVDWGYKRDEDVRGAPYDWRKAPNENRDYFVA
LRKMIELMYEQYGSPVVLIAHSMGNMYTLYFLNHQSQDWKDKYIKDYVSLGAPWGGVAKT
LRVLASGDNNRIPVISSLKIRDQQRSAVSTNWMLPYNYTWPPDKVFVSTPTANYTLRDYQ
KFYRDINFEDGWLMRQDTEPLVYQMTPPGVRIHCLYGTGVETPDSFYYESFPDKEPKILY
SDGDGTVNLQSALQCQKWVDMQKQEVVIFELSGNEHIQMLSNDTTISYVKKLLFDL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctgtccctgaccagcagtcctccatcacggccaactccccccagttcatat
actgagcgtgacgtcataagaaatcttcacgatcacacagctgtagatggagtaacgtgg
gacgaacgcactcctgccgcagcacgcctccctcccgacgtgcgtactgccagccgggac
cacaggcctcttgcccgcacctgcggggcgccctacctgtcggctctgcctcacaccggc
cgggccaggcccgcggcagccgggggcccccggaagttctgcaataagtgtttctctgaa
agcgtatctaggggtccagttccaggggacttaggcaatcagttggaagcaaagttagat
aagccatcagtagtgcactatctctgctctaagaagacagacagttattttacactctgg
ctgaatttagaattgcttctgcctgtcatcattgactgctggattgataatatcaggctg
gtatataatcgaacaagtaagaccacagaaccaccagatggagtggatatcagagtccca
ggttttgggcagacattttccttggaattccttgacccaagtaaaaggagtgttggcagt
tacttttatatgctggtgcaaagtttagtggactggggctacaaacgtgatgaagatgta
agaggagcaccttatgactggcgaaaggcaccaaatgagaacagagactattttgtggcc
cttcgcaagatgatagagttaatgtatgagcagtatggaagtcctgttgtcttaattgcc
cacagtatgggtaatatgtacaccctctacttcctcaaccatcagagtcaggattggaaa
gacaagtacataaaggattatgtgtcattaggcgctccatggggaggagtggctaaaact
ctccgtgtgctggcttcaggtgacaataatagaatacctgttatcagttcactcaagatt
agagaccagcagagatcagcggtttccacaaattggatgcttccctacaactacacatgg
cctccagataaggtctttgtaagcacacctacagctaactacactcttcgggattaccaa
aaattctacagggacatcaattttgaagatggctggctcatgagacaagacactgaaccc
ctggtctaccagatgacaccgcctggtgtgcgcatacactgcctttatggtactggcgtg
gaaacacctgattccttctattatgaaagttttcctgacaaagaacccaagattctttac
agcgatggggacggtacagtgaacttacagagtgccttgcaatgtcaaaagtgggtggac
atgcaaaaacaggaagtggtgatctttgagctttcaggaaatgaacatattcaaatgcta
tccaatgatactactatctcctatgtgaaaaagctgctttttgatttgtga

DBGET integrated database retrieval system