KEGG   Nipponia nippon (crested ibis): 104017967Help
Entry
104017967         CDS       T05756                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00350  Tyrosine metabolism
nni00360  Phenylalanine metabolism
nni00380  Tryptophan metabolism
nni01100  Metabolic pathways
Module
nni_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
nni_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104017967
   00360 Phenylalanine metabolism
    104017967
   00380 Tryptophan metabolism
    104017967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nni04147]
    104017967
Enzymes [BR:nni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104017967
    4.1.1.105  L-tryptophan decarboxylase
     104017967
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104017967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 104017967
NCBI-ProteinID: XP_009469325
Position
Unknown
AA seq 238 aa AA seqDB search
MDAAEFRKRGEEMVNYIADYLEKIDKRQVFPDVEPGYLRPLIPDCAPQDPESFEDVFKDI
EKIIMPGVTHWHSPYFFAYFPTASSFPALLADMLCTGIGCVGFSWAASPACTELEIITLD
WLGKMINLPEEFLAGNGGQGGGVIQGSASEATLVSLLAARTKAIRRVQSEKPELTEADIM
GRLVAYTSDQAHSSVERAALIGGVKIKNVSSDDTFSVCGSALKKVLDEDKASGLIPFF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagagttccgcaagagaggggaggagatggtgaactacattgcagattac
ctggagaagatagataaaagacaggtcttcccagatgtggaaccaggatatctaaggccc
ctcattccggactgtgcaccccaggatcccgagagctttgaggatgtctttaaagacatt
gagaagatcattatgccaggggtgactcactggcacagtccatacttttttgcctacttc
cctacagcctcttccttcccagctcttcttgcagatatgttatgtactggaataggatgt
gtgggcttttcttgggccgcaagtccagcttgcacagagctggagattatcacgctggat
tggctagggaagatgattaatttgcctgaagagtttttagctgggaatggtggccaaggt
ggaggagtcattcagggaagtgcaagcgaggccacgctggtttcactgcttgctgcaaga
accaaggctatcagacgagtgcagtcagaaaagccagagctaacagaagcagacatcatg
ggcaggctggtggcctatacttctgatcaggctcattcgtcagtggaaagggctgcgtta
attggtggtgtgaagatcaaaaatgtttcttcagatgatacatttagtgtttgtggttca
gccctaaagaaagttttggatgaagacaaagcttctggtcttatcccgttcttt

DBGET integrated database retrieval system