KEGG   Nipponia nippon (crested ibis): 104018171
Entry
104018171         CDS       T05756                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104018171 (AHRR)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104018171 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 104018171
NCBI-ProteinID: XP_009469553
Position
Unknown
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNVSNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQTETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAVNTN
SSSKGNSGLCEATEFYGRNSHHEGAAFTNVLQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANAQLLYRSGCSEYVLAQQQMLKEEDEQLKIPSSFANLKGNLEGLPYNSAIETLGQ
WKHLNWTAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLSVQNNCTTNSSWTLRNSS
SSSMSQRMNTCSNRRAGSFYNRDQSFLNLASTCPSHWGSAESCQSYSGVQQRCAENYATD
HLKLQRPLIPSESLYDTAFPLEMPIKTEYDSDSENIADNYLTSQNRAWLDENGSVRKQVF
SYPNRMHLKTEPDLCEPASPCQKPRHCLYTPHNWQCIVANHPSNLNLNRSCKGSRNKEVA
PFCPQNSSGCLESVPDLPHMACYGHFYSPSTGEEKEQNNEVFKMPCEFKTPCLVQAIKRE
PLDSPPLSNSGQNRVTMSFPENTLADPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtacgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcaaagagacacagggaccgtctg
aacgcggaactggaccacctggccagcctcctgccttttccacctgacatcatatcgaag
ctggacaaactttctgtcttgcgtcttagtgtcagctatctccgagtcaaaagtttcttt
caagccatccaagaaaagcactttaagaagcaagttggccaaacaataaaagaagacaat
gtatctaacaagactgctgtacaagaaggtggacttctactagaatcactgaacggtttt
gcgttggtggtgagtgcagatggaatgatattttatgcatcatcgacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaatcctccccagatgttgtct
ggacagcaactgcagacagaaacaggagaagaatatattctcagtaaattgtttaaagca
caagagaatgacagcatgacgacagattattcttccttcttaactcgttgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttccttacaatgcagttccaaggaaaa
ctaaagtttctttttggacaaaggaagaagtcctcatcaggaacagtattgccacctcag
ctgtccctattctgcatagtggtaccacttctgctcccttccgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagtgaatacaaac
tccagttccaaaggcaattcagggctgtgtgaagcaacagaattctatggaagaaacagt
catcatgaaggtgccgctttcactaatgtgttacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttccctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacgctcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacaactgaagataccaagcagttttgcc
aatttgaaaggaaacctggagggacttccctataacagtgccattgaaactctgggccag
tggaagcatcttaactggacagcagtaaaaaatgaacaagataatgtaaaagtgaagttt
gagcctcatacaaacggtgagtgttttatgcaagaggaacctctcagttctaacacgtca
gttttaagtgttcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagc
tcttcttctatgagccagcgaatgaacacatgttcaaacaggagagctggatcattctac
aacagagaccaaagtttcttaaatttagcatcaacttgcccttcccactgggggagtgca
gaaagctgccagtcttactcgggcgtacaacagcgttgtgcggagaactatgcgacggac
cacctgaaactgcagagaccgttaataccctcagagtctctctatgacacagcctttccc
ttggagatgcctatcaaaacggaatatgattccgattctgaaaacattgctgataactac
ctgacgtcgcaaaaccgagcctggctggatgagaacggctcggtgagaaagcaggtgttt
agctaccccaatagaatgcacctcaaaacagaaccggacctctgtgagccagcctcacct
tgtcagaagccaaggcactgcctttacacgcctcataactggcaatgcatcgtagcaaat
catcccagcaacctaaacctgaacaggtcttgcaagggttcacgtaacaaggaggtggcc
ccgttttgccctcagaactcctccgggtgtttggaaagcgtgcctgacctgccgcacatg
gcatgctacggccacttctacagccccagcacaggggaggagaaagagcagaataacgag
gtgtttaaaatgccgtgtgaatttaaaaccccttgcttggttcaagcaatcaagcgtgag
cccctggattctccaccattgtccaacagtggacagaacagagtaacgatgagcttccct
gaaaatacattagcagatcctgtgcctcataaaaccactgaatgtacatttttacaatag

DBGET integrated database retrieval system