KEGG   Nipponia nippon (crested ibis): 104018457
Entry
104018457         CDS       T05756                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00230  Purine metabolism
nni00240  Pyrimidine metabolism
nni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104018457
   00240 Pyrimidine metabolism
    104018457
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104018457
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 104018457
NCBI-ProteinID: XP_009469874
Position
Unknown
AA seq 279 aa
MEARPHRLLIGGTAFWRWRLQPFSRNVHYHRASVLASPAPAGQRPARAAGKSTFVRLLEK
HSDEWEIIPEPIAKWCNIQTAEDEYKELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLS
RVRAQLKPVSAKLHEAEHPVQFFERSVYSDRYVFTSNLFESGNINETEWAIYQDWHTWLL
NQFESDIELDGMIYLRTTPQKCMERLQMRGREEEQGIELEYLENLHYKHETWLHERTMRV
DFENLKDIPILVLDVNEDFKNDKIKQEYLIDKVKSFLTS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggaggcgaggccccaccgcctccttatcggcggcacggccttctggcgctggcgatta
cagccgttttctcggaacgtgcactaccaccgtgcaagcgtcctcgccagccctgccccg
gcaggccaaaggcctgcccgggctgcagggaagtcaacatttgtcaggctactagagaaa
cacagcgatgagtgggagatcatccctgaacccatcgccaagtggtgcaacatccagaca
gctgaagatgaatacaaggaactttcaacatctcagaagagtggaggaaatctacttcaa
atgctgtatgataaacccacaagatgggcttatacatttcagacctatgcttgcttgagc
cgagtaagagcacaattaaaacctgtctcagccaagctacatgaagcagaacatccagtg
caattttttgagagatctgtgtacagtgacagatatgtattcacttctaacctgtttgag
tctggaaacattaatgaaacagagtgggctatttatcaggactggcacacatggcttttg
aatcagtttgaatcagacatagaactggatggcatgatctacctaagaaccacacctcag
aaatgcatggaaaggctacagatgaggggaagagaagaggagcaaggaattgagcttgag
tatttggaaaacctccactataaacatgaaacctggcttcatgaaaggactatgagagtt
gattttgagaaccttaaagatattcccattctagttttggatgttaatgaagactttaag
aatgataagattaaacaggagtacctgattgataaagtcaagtctttcctgacttcttaa

DBGET integrated database retrieval system