KEGG   Nipponia nippon (crested ibis): 104018530Help
Entry
104018530         CDS       T05756                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104018530 (THNSL2)
Enzymes [BR:nni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     104018530 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF4715 Glyco_transf_56
Motif
Other DBs
NCBI-GeneID: 104018530
NCBI-ProteinID: XP_009469958
Position
Unknown
AA seq 483 aa AA seqDB search
MEYVSTRGGAGAVNFEGALFSGYAPDGGLFMPQRIPSLDRDTLRRWSCLSYLELVKELCS
LFITAELVPRSMLNDLIDRAFSRFRHKDVVHLSRLKDGLNVLELWHGVTYAFKDLSLSCT
GQFLQYFLEKNQKHVTILVGTSGDTGSSAIESVRGQKNMDIFVLLPKGFCTHIQELQMTT
VIEDNVHVFAAHGNSDEIDEPIKELFADVDFARKYNLMSLNSVNWSRIMVQIAHHFYAYF
QCAPSLDTTPLPVVEIVVPTGGGGNITAGCIAQKMGLPIRLVAVVNSNDIIHRTVQHGDF
SLSESVKATLASAMDIQEPYNMERILWLLSGSDSCLMKTLMERFSMSKSLKLPEDLHRKL
SKTLHSCSASDEDIVRAMQRCWEENHYLLCPHSAVAAHYHYSQPVGTPRCCLAPASAAKF
QDALLRAGLVPQLPPEITALTAMETRSTPLERGQDWARELREQIEAVAQRREWGVTGQGV
TQT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgtcagcacacggggaggcgcgggggccgtcaacttcgagggagccctcttc
tccggctacgcacccgatgggggtctcttcatgccccagcgcatcccctcgctggacagg
gacaccctgcggaggtggagctgcctttcctacctggagctggtgaaggagctctgctcc
ctcttcatcacagcagagctggtcccgcggagcatgctcaacgacctcattgacagggcc
ttcagcaggttcagacacaaggacgtcgtccatttgtccaggctgaaagatgggctgaat
gttttggagctgtggcacggagttacttatgcttttaaggatctgtccttgtcctgcaca
gggcagtttttacagtatttcttggagaaaaaccagaagcacgtcactattctggtgggg
acttcaggggacacagggagctcggccatcgagagtgtgagagggcagaagaacatggac
atctttgttctgctgcccaaggggttctgcacccatatacaggaacttcagatgaccacc
gtcattgaagacaacgtccacgtttttgctgctcatgggaacagcgatgaaatcgatgag
ccgatcaaggaactgttcgctgatgttgattttgccagaaaatacaacctgatgagcttg
aattcagtcaattggtcgaggattatggtgcagattgctcaccacttctacgcttacttt
cagtgcgccccgtccctggataccaccccgctgccagtggtggaaattgttgtgccaaca
ggaggaggaggaaatatcacagctggctgtattgcccagaaaatgggtctcccaattcga
cttgttgccgtggttaacagcaatgacatcattcataggactgttcaacatggagatttc
tcactgtcagagagcgtgaaggctacattagcatcagccatggatattcaggagccttac
aacatggagaggatcctctggctgctctcgggctccgacagctgcctgatgaaaacgctg
atggagcgattcagcatgtcgaaaagccttaagctgccggaggatttgcacagaaagctc
tccaagaccctgcactcgtgctcagcctccgatgaggacatcgtgcgagccatgcaacgc
tgctgggaggaaaatcactacctgctgtgcccccactccgccgtggctgctcactaccac
tactcgcagccggtcggcactccccggtgctgcttagctccagcctctgcagccaaattt
caggatgccctgctccgagctggcctggttccccagctcccccctgaaattactgcctta
acagcgatggagaccaggtccactcctctggagcggggacaggactgggcacgggagctc
cgggagcagattgaagccgtggcacagcggcgggagtggggggtcaccgggcagggagtg
acacagacctga

DBGET integrated database retrieval system