KEGG   Nipponia nippon (crested ibis): 104018559Help
Entry
104018559         CDS       T05756                                 

Gene name
SUCLG1
Definition
(RefSeq) succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00020  Citrate cycle (TCA cycle)
nni00640  Propanoate metabolism
nni01100  Metabolic pathways
nni01200  Carbon metabolism
Module
nni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104018559 (SUCLG1)
   00640 Propanoate metabolism
    104018559 (SUCLG1)
Enzymes [BR:nni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104018559 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104018559 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 104018559
NCBI-ProteinID: XP_009469990
Position
Unknown
AA seq 371 aa AA seqDB search
MAQAYGQASLNFFVFSLNQDSSVILENAQKLLILEKYIYIDFSKLRIDKLKLSKTFLLQQ
NGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKGGKTH
LGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRV
KHRLLRQDKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQ
VGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPHTEGIILIGEIGGNAEEDAAAFLKENNS
GPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGST
IYKEFEKRKLL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcctatggccaggcttctttgaacttctttgtattttctctgaaccaggac
tcttcagtcatcttggaaaatgctcaaaagcttcttatccttgaaaaatatatctatata
gacttctcaaaactgagaattgacaaacttaagctttcaaaaacatttttgttgcaacag
aatggagtacgacactgctcctactcggcatcaaggaaaaatctgtatattaacaaaaat
acaaaggttatctgtcagggttttacaggcaaacagggcacctttcacagccagcaggcg
ttggactatggcaccaatctagttggaggaatttctccagggaaagggggaaaaactcat
ctgggtctgcctgtgtttaattctgtgaaggaggccaaggaacaaactggtgcttctgcc
actgttatatacgtacctcctccgtttgctgctgctgcgatcaacgaagcaatcgatgca
gaaatgcccttagttgtatgcattactgaaggtattcctcagcaggacatggttcgggtt
aaacacagactgcttcggcaggataagactcgactagtgggcccaaactgccctggagtc
atcaatcctggagaatgtaaaattggcatcatgcctggtcacattcacaagaagggaaga
attggtattgtgtcaagatctggaacgctgacatatgaagctgttcatcagacaacgcaa
gttggattggggcagtctttctgcgttgggattggaggcgatcccttcaatggaactaat
tttattgactgccttgatgttttcctgaaggatcctcatactgaggggatcatattgatc
ggggaaattggaggaaatgctgaagaagatgcagcagcattcttgaaagaaaataattct
ggtccaaatgccaagccggttgtgtcattcatagctggtctgaccgctcctccaggcagg
cggatgggtcatgctggagcaatcattgctgggggaaagggtggagctaaagagaagata
gccgctcttcagagcgctggcgttgttgtcagcatgtctcctgctcagctaggtagcacc
atctacaaggagtttgagaaaaggaaactgctgtaa

DBGET integrated database retrieval system