KEGG   Nipponia nippon (crested ibis): 104019339Help
Entry
104019339         CDS       T05756                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104019339 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104019339 (MAP4K4)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104019339 (MAP4K4)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: STE group
  STE20 family
   104019339 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 104019339
NCBI-ProteinID: XP_009470860
Position
Unknown
AA seq 1328 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNE
RQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRD
FLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREARRQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEE
QRHLEILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRQQQQQ
QQQQQQQQERNKQSYHTPEPKSHYEPAERAREVEERFRKTNQGSPEAQSKQMGKVLEPPV
PSRSESFSNGNSEPAQPALQRPMEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHL
RSQDPYPPSRSEVLNQSSDSKSEVPDPTQKAWARSDSDEVPPRVPVRTTSRSPVLSRRDS
PLQGSGQQNNQAGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQS
GSGERFRMRSSSKSEGSPSQRHESAPKKPEEKKEVFRPIKPAGEVDLTALAKELRAVEDV
RPPHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPDDVRAVSTLNLSNGETESVKTM
IVHDDVESEPALTPSKEGTLIVRQSTVDKKRASHHESNGFAGRIHLLPDLLQQSHSSSTS
STSSSPSSSQPTPTMSPQTPQDKLTTNETQSASNTLQKHKSSSSFTPFIDPRLLQISPSS
GTTVTSVVGFSSEAMRSEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILC
AALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRV
YYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWA
PKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPT
HIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSN
QIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL
GRTSLLSW
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atggacgttactgaggacgaagaagaagaaatcaaactggagattaatatgctaaagaaa
tattctcatcatagaaatattgcaacttactatggtgctttcattaagaaaagtcctcca
ggtcatgatgaccaactgtggcttgttatggagttttgtggagcaggctctatcacagac
cttgtgaagaacacgaaagggaatactctgaaagaagactggatagcatatatctccaga
gagattctccgggggttggcacatcttcatgcccaccatgtgattcaccgggatatcaaa
gggcaaaatgttttgttaacagagaacgcagaagtgaaactcgtggatttcggtgtgagc
gctcagctggacaggacagttggcaggagaaacacttttattggaactccatactggatg
gctccagaagttattgcctgtgatgaaaatccagatgctacgtatgattacagaagtgac
ctttggtcatgcggcattacagccatagagatggcagaaggagctcccccgctttgtgac
atgcatcccatgagggcactctttctgatacccaggaaccctcccccacggttaaaatcc
aagaaatggtcaaaaaagtttttcagctttatagaaggttgtctagtgaagaattacatg
cagcgaccttctacagaacaactcttgaaacatccctttatacgtgaccaaccgaatgaa
aggcaagtccgaatccagcttaaggaccatatagacaggaccaggaagaagagaggagag
aaagatgaaacagagtacgaatatagtggaagtgaggaagaagaggaggaagtgcctgaa
caagaaggagagccaagttccattgtcaatgtgcctggagaatcaaccctccgacgtgat
ttcctgagactacagcaggaaaacaaggaacggtccgaggcccttcggagacagcagctg
ctgcaggagcagcagctccgcgagcaggaggagtacaagaggcagctgctggcagagagg
cagaagcgcatcgagcagcagaaggagcaaaggaggcggctagaagagcaacaaagaaga
gaacgggaagctcgtaggcaacaagagcgtgagcaaaggcggagggaacaggaagaaaag
agacgtctggaagaaatggagaggaggcgtaaggaagaggaagagagaagaagagcagag
gaggaaaagaggagagtagaaagggagcaggagtatatcaggcgacagctagaagaggag
cagcggcacttggaaattctacagcagcagctgctccaggagcaggccatgttactggaa
tacagatggcgagagatggaggaacaccgacaggcggagcgactccagcgccagttgcag
caggagcaagcctatctcctgtcgctgcagcatgatcacaggcggcagcagcaacagcaa
cagcagcaacagcagcagcagcaagaaagaaataaacaaagctatcatacccctgagcca
aaatcccactatgagcctgctgaaagagcgcgtgaggtggaggagagatttagaaaaact
aatcagggttcccctgaagcacagtctaagcagatgggcaaagtgttggagccaccagtg
ccttcaagatcagagtccttttccaatggaaactcagaacctgctcagcctgccctgcag
aggccgatggagccccaggtacagtggtcccatctggcatctctcaagaacaatgtttcc
cctgtctcgcgatcccattccttcagtgacccttctcccaaatttgctcatcaccatctt
cgttcccaggacccatatccaccttcacgcagtgaagtgctaaatcagagttctgactct
aagtcggaggtacccgaccccacccaaaaggcttgggctagatcagacagtgacgaggtg
cctccaagggtacctgtgagaacaacgtcccgatcaccagtcctgtcccgccgtgattct
ccactgcagggtagcggccagcaaaataaccaagcaggtcaaagaaactcaacgagcaat
atagagcctcgtctgctgtgggaaagggtggagaagctcgtaccaagaccgggcagtggc
agttcttcaggttcaagcaactccggctcacagcctggctcccaccctggctctcagagc
gggtctggagagcggttccggatgagatcatcatccaaatcagagggttcgccatctcag
cgtcatgaaagcgcacctaaaaagcctgaagagaaaaaggaggtcttcagacctatcaag
cctgctggagaagtggatttaactgcattggcaaaggaattgcgagcggtagaggatgtg
cgacctccacataaagtgacggattattcatcctcaagtgaggagtcagggacgacagat
gaagaagatgatgatatggaacaagaaggagcagatgaatctacttctggaccagatgat
gtccgagcagtgtcaacattgaacttgagcaatggtgaaacagagtcagtgaaaaccatg
attgtccatgacgatgtggagagtgaacctgccttgactccttctaaggagggcacctta
attgtccgacagagtacagttgacaaaaagcgtgccagccatcatgagagcaatggcttt
gccggtcgcattcacctcttgccagatctcttacagcaaagccattcctcctccacttcc
tccacctcctcctccccatcctccagccagccgacacccaccatgtccccacagacaccc
caggacaagctaactactaatgagactcagtccgctagtaacacactccagaaacacaaa
tcttcctcctcctttacaccttttatagaccccagattactacagatttctccatctagc
gggacaactgtgacttctgtggtaggattttctagtgaagcaatgagatcagaggcaata
aggcaagaccctacacggaaaggatcagttgtcaatgtgaatcccacgaatacacggcca
cagagtgataccccagagattcgcaaatacaagaagagattcaattctgagatactgtgt
gctgccttatggggagtgaacttgttagtgggcactgaaagtggtctgatgctgctagac
agaagtggtcaggggaaggtttatccgctcattaatcgaagacgattccagcagatggat
gtacttgaagggctgaatgtcttggtgacaatttctggtaagaagaacaagttgcgagtc
tactatttgtcctggttaagaaataaaatccttcacaatgaccctgaagtagaaaagaaa
cagggctggacaacggtgggcgacttggaaggctgtgtgcactataaagttgtaaaatat
gaaagaatcaagttcttggtaattgcattgaagagttctgtggaagtctatgcatgggca
ccaaagccataccataaatttatggcctttaagtcatttggagaattggtacataagcca
ttgctggtggatctaaccgtagaagagggtcagagactaaaagtgatctatggctcctgc
gctggcttccatgccgttgatgtggattcaggatcggtctatgatatatatctaccaaca
catatccagagtagtatccaacctcacgcaatcatcattctcccaaacacggatgggatg
gagctactggtctgctacgaggatgaaggagtttatgtcaacacgtatggaaggatcacc
aaggatgtggttctgcagtggggagaaatgccaacttcagttgcatacatccgatccaac
cagattatgggctggggagaaaaagctatcgaaatacgatcggtggaaactggacacttg
gatggtgtgttcatgcacaaaagggcacaaagactcaagttcttatgcgaacgcaatgac
aaggttttctttgcctccgtacggtcgggtggaagcagtcaagtctatttcatgaccctt
ggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system