KEGG   Nipponia nippon (crested ibis): 104019386
Entry
104019386         CDS       T05756                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nni03021]
    104019386 (AFF3)
Transcription machinery [BR:nni03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     104019386 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int MACPF
Other DBs
NCBI-GeneID: 104019386
NCBI-ProteinID: XP_009470917
Position
Unknown
AA seq 1176 aa
MSSSFCCSVYEPDRNVLRRKEWERRNQEAQQEDGAFNTSYSLFSEPYKTNKGDELSNRIQ
NTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKPDEHLIADSRPPPPPPISSTTSS
TPAALPAQQSKSTTMGWQKAGRNAASDGQQRVSKHGSLRATLGDNVTRVQQPAKLNCGSE
GGAQAQERPAKHGGGHCVQNFPPSLASKPSLVQQKTTAYVRPMDGQDQAPDESPKLKLPA
ETTKSYRGVPSNKPDSSRTKSKIAKFSIPKQEEDSRAGRNNSCIEEILREMTHSWPPPLS
AIHTPGKAEQSKFPFPNKEPQQGSTGHSNTSKSDVEPKGPEKSATHTSMLEDDLKLSSDE
EETDQQAAQRSALRVLSDSLVVPQSNARASGLSSKGSSSSSSSESETSSESDSESESSSS
ESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAHPYYGRVKAD
RQESEKTPAAGPAEHRSGEGRATTTAATAIGDGPRPRTANKAPGSKGSRQKSPPAADGGP
PRRAAGKKAPRRAERTSAGDGPHCPEAPGGGARGPRPGGSSSGSGCRAGHRREPRSAAAG
EKRRARGPSKTAPKSKEFIETESSSSSSSSDSGSESEREERPLPKVPAAAGAGAEPRAKD
TGTGAASKPHGGCSAFGSINARTSSEIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSLW
VNIDLALLSRIPERLPEEPLAMSAGANQAASLPQGSSADPPAEKGLPKSRRKRKCENEEE
CRDIKKTHLEREGSSRLAASAHSITTANHCNMNENSLAIPINKNEKMLRSPVSPLSDASK
HKYSNDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPHPGDFNKAIHINSENVLLCNKPQ
SQTEPWSPLSSTPRDCRRTKLIFDDMPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEA
ALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSGPNATPEDKQLAALCYRC
LALLYWRMFRLKRDHAVKYSKALVEYFKNSSKAAQNPSPWGASGKSTGTPSPMSPSPSPV
SSVGSQGSTGAPSPSPIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFFN
DLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3531 nt   +upstreamnt  +downstreamnt
atgtcttcctctttttgctgcagtgtctacgagccggatagaaacgtgctgcgaaggaaa
gaatgggaaaggagaaatcaggaggcccagcaggaggatggcgcgtttaacacgagttac
tccctcttcagtgaaccgtacaagactaacaagggggacgagctctcgaatcgcatccag
aatacgttaggcaactatgatgaaatgaaagacttgttaactgaccgatcaaaccagagc
caccttgttggggttccaaaacctggggttcctcagacgtctctccccaagcccgatgaa
catcttattgcagactcaagaccaccgcctcctcctcccatttccagcactacttcttcc
acaccagcagccctacctgcccagcagagcaaaagcaccacaatgggttggcagaaggct
gggcgcaatgccgcttcggatggccagcagagagtgagcaagcatggctcactgagggcc
acgctaggagacaacgtcaccagagtgcagcagccggcaaagctcaattgtggctcagaa
ggaggagctcaagcgcaagagaggccagcaaagcatggtggcgggcattgtgtccaaaac
ttcccaccctctcttgcttcaaagcccagtctggtncagcagaaaacaacagcttatgta
aggccaatggatggtcaagaccaggctcctgatgagtctccaaagctgaagttaccagca
gagacgaccaagtcatataggggagtgccttcaaacaagcctgattcgtccaggaccaag
tcaaagatagccaagtttagcattcctaagcaagaagaggattccagagctggacgcaat
aacagctgcattgaagaaatattgcgggagatgacccattcatggcctccgccactgtca
gctattcacacaccaggaaaggcagaacaaagcaagtttcccttcccaaacaaggagcca
caacagggatctacaggacacagcaatacaagcaaaagtgatgtagagccaaagggtcca
gagaaaagcgcaacccatacatcgatgctagaagatgacctcaagttaagcagcgacgaa
gaagagactgaccagcaggcagcacagagatctgctctccgcgttctatctgacagcctg
gtggtgccgcagtccaacgcccgagcctcgggactctccagcaaggggtcaagcagcagc
agctccagtgaatccgagaccagctcagagtctgactcagagagcgaaagcagctccagc
gagagtgacggcagcaagccctcgcattactccagcccagagcctgagccaccctcgtcc
aacaagtggcagctggacaagtggctgaataaagtcaccccgcacaaagcacccatcctg
acccaccatgacggcccggcgctggaggcccatccctactacggccgcgtgaaggcagac
cggcaggaaagcgagaagaccccggccgccggcccagccgagcaccgcagtggggagggc
cgcgccaccaccaccgctgccacagccattggggacggaccacggcccaggactgcaaac
aaagcgccgggcagcaagggcagccggcaaaagtcacctcccgctgctgacggcgggcct
ccgaggcgggcagcagggaagaaggcaccgcggcgggccgagaggacctctgccggggac
ggcccccactgccccgaagccccggggggcggggcccgggggccccgcccgggcggcagc
agcagcggcagtggctgcagagcagggcaccgccgggagccccgctcagctgcagccggt
gagaagcgtcgggcccgggggccgagcaaaacggcacccaaatccaaggagttcattgag
accgagtcttcgtcttcgtcatcctcctccgactcgggctctgagtcggagcgggaggag
cgcccactgcccaaggtgccggccgcggccggggccggggccgagccgcgcgccaaggac
acggggaccggtgctgccagcaaaccccacggcggctgcagtgcctttggctccattaat
gccaggactagtagtgaaatagcaaaggagctggaggaacagttttacaccctggttcct
ttcggtaggaatgagctcctgtctcctctgaaagacagtgatgaggtaaagtcactgtgg
gtcaacattgacttggctcttttgtccaggattccagagcgtttgcccgaagagccgctg
gccatgagcgccggagcaaaccaggcggccagcctcccgcagggtagtagtgctgacccc
cccgcagagaagggtttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaagag
tgcagagacatcaagaagactcatttagagagagagggttcttcacgattagctgcctct
gcccacagcatcacaacagcaaatcactgcaatatgaatgaaaatagcttggcaatacca
ataaataaaaatgagaaaatgcttcggtcacccgtctctcccctctctgatgcatcaaaa
cacaaatactccaacgatgatttaacttcctccagcagacctaatggcagcagtctatta
ccttccatctcctccagcaaaaaacataagggtgaaatccagtcacagccacatcccgga
gacttcaataaagcaattcacatcaattcagaaaatgttcttctctgcaataagccccag
tcccaaacagagccttggtcacctctgtccagcacacccagggactgcagaaggacaaag
cttatcttcgatgatatgccacgcaatgcagattactttatgcaggaagctaaacggaag
aagcataaagcagatgcaatggtggaaaagtttggaaaggcactgaattatgcagaagca
gcactatcgtttattgagtgtggaaatgcaatggaacaaggcccaatggaatctaaatcc
ccttatacaatgtattcagaaacagttgaactcatcaggtatgcagtgagactaaaaacc
cactcaggccccaacgccacgccagaagacaaacagctggcagcattatgttaccgctgc
ctggcccttctgtactggaggatgtttcgactcaagagagaccacgcggtcaagtattcg
aaagcgcttgtggagtatttcaagaattcatcaaaagctgcccagaacccatctccttgg
ggtgccagtggaaagagcacaggaactccatcacccatgtcccctagcccttctccagtc
agctctgtaggatcccaggggagcacaggggccccttccccgtctcctatcatcagcatc
ccgcagcgcattcatcagatggccgccaaccacgtcagcatcaccaacagcatcctgcac
agctatgactactgggagatggctgacaacctggctaaggagaacagagatttttttaac
gacttggatgcattgatgggacctatcaccttgcacagcagtatggagcatttagttcag
tacactcaacaaggacttcactgggtgcggaatagcgctcacttgtcataa

DBGET integrated database retrieval system