KEGG   Nipponia nippon (crested ibis): 104019831Help
Entry
104019831         CDS       T05756                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104019831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nni04030]
    104019831
G protein-coupled receptors [BR:nni04030]
 Rhodopsin family
  Lipid
   Leukotriene
    104019831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 104019831
NCBI-ProteinID: XP_009471439
Position
Unknown
AA seq 232 aa AA seqDB search
MSLSPTNASAFSNATSAPVPGAAVGLTLLAVAVALGLPGNAMVLWSCAVTRRRGVPVLLI
FHLALADVVTLLTGPIYLRALSVGQWNMGLAVCRGCHYLCAAAMYVSVFLIALLGLHRCL
AVSRPATAVVTASDRAGRLAHGAAAVTWSVALVLAIPSIVFRRVQNGHCQRVHSTEVWLV
IHNLLETILGWALPLTAVATGYGLLVRRLRQTRLGRRGPTGVKLFFYLKMML
NT seq 697 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgtcacccaccaatgcctcagccttctccaacgccacgtccgcccccgtcccc
ggcgcggcggtggggctgaccctgctggcggtggcggtggcgctgggcctgccgggcaac
gccatggtcctctggagctgcgccgtcacccgccgtcgcggcgtccccgtcctcctcatc
ttccacttggccttggccgacgtggtcaccctcctcaccggtcccatctacctccgggcc
ttgagcgtcggccaatggaacatgggcttggccgtctgccgcgggtgtcactacctctgt
gccgctgccatgtacgtcagcgtcttcctcatcgctcttctgggtctccatcggtgcttg
gcggtctccaggccggcgacggcggtggtgacggcgagtgaccgtgctggacggttggcc
cacggcgcggcggcggtgacttggtcggtggctttggtgttggccatcccatccatcgtc
ttccgacgggtgcagaacgggcactgccagcgggtgcacagcacggaggtttggttggtc
atccacaaccttctggagaccatcttgggttgggctctaccattgaccgccgtagccaca
ggctacgggttactggtccgccggttacgccagacccgcttgggccggcgcggcccgacc
ggtgttaaactttttttctacctgaaaatgatgcttt

DBGET integrated database retrieval system