KEGG   Nipponia nippon (crested ibis): 104020060Help
Entry
104020060         CDS       T05756                                 

Definition
(RefSeq) septin-2
  KO
K16942  septin 2
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104020060
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nni04812]
    104020060
   04147 Exosome [BR:nni04147]
    104020060
Membrane trafficking [BR:nni04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    104020060
Cytoskeleton proteins [BR:nni04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     104020060
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104020060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 Ras Dynamin_N AAA_22 Roc AAA_16 AAA_7 Gtr1_RagA AAA_29 ABC_tran Sec2p
Motif
Other DBs
NCBI-GeneID: 104020060
NCBI-ProteinID: XP_009471706
Position
Unknown
AA seq 349 aa AA seqDB search
MSQSGEKVKFSDSAGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTD
LYPERYIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFKTIIQY
IDNQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVEFMKALHGKVNIVPVI
AKADTLTLKERERLKRRVLDEISEHGIRIYQLPDADSDEDEEFKEQTRVLKASIPFAVIG
SNQLIEVKGKKIRGRLYPWGVVEVENPEHNDFLKLRTMLVTHMQDLQEVTQDLHYENFRS
ERLKRTGKPVEEEVVDKDRILQQKEAELRRMQEMIAQMQAQMRMKPGDD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcaggtgaaaaagtaaagttttccgactcagcaggctatgtgggattcgct
aatctgcccaaccaggttcacaggaaatctgtgaaaaagggctttgaattcacactgatg
gtggttggtgagtctggcttgggaaaatccactttaattaacagtctgttcctgactgat
ctttatccagaacgttatattcctggagctgcagagaaaatagagagaacagttcaaatc
gaagcttctacagtagagatagaggagcgaggggtgaagctgcgtttaacagtagttgac
acaccaggatatggagatgccatcaacagccaggactgcttcaaaacaattatccagtac
attgacaaccagtttgaaagatatcttcatgatgagagcggtctcaacaggcgccacatt
atagacaacagagtccattgctgtttttacttcatctctccctttgggcatgggctgaaa
ccattagatgtggaattcatgaaggctcttcatggaaaagtcaacattgtccctgtgatt
gccaaggctgacacactgacgctgaaggagagagagaggctgaagagaagagttctggac
gagatttctgaacatggcattaggatttatcagctccctgatgcagattctgatgaagat
gaggagtttaaagaacaaaccagggttttaaaggctagcattccttttgccgttattgga
tccaatcaacttattgaggtgaaggggaaaaaaatcagaggccgcctgtatccctgggga
gttgttgaagttgaaaatccagagcacaatgatttccttaaactgcgcacaatgctggta
acacacatgcaggacctgcaggaggtgacccaagatttgcactacgagaacttccgttcg
gagaggctaaaacgaactggcaagcccgttgaagaagaagtggtagacaaggatagaatc
ctccagcagaaggaggctgagctgcgccgcatgcaggagatgattgcacagatgcaagcc
caaatgaggatgaagcctggtgatgattaa

DBGET integrated database retrieval system