KEGG   Nipponia nippon (crested ibis): 104020347Help
Entry
104020347         CDS       T05756                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00564  Glycerophospholipid metabolism
nni00565  Ether lipid metabolism
nni00590  Arachidonic acid metabolism
nni00591  Linoleic acid metabolism
nni00592  alpha-Linolenic acid metabolism
nni01100  Metabolic pathways
nni04010  MAPK signaling pathway
nni04217  Necroptosis
nni04270  Vascular smooth muscle contraction
nni04370  VEGF signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104020347
   00565 Ether lipid metabolism
    104020347
   00590 Arachidonic acid metabolism
    104020347
   00591 Linoleic acid metabolism
    104020347
   00592 alpha-Linolenic acid metabolism
    104020347
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020347
   04370 VEGF signaling pathway
    104020347
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104020347
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104020347
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104020347
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104020347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 104020347
NCBI-ProteinID: XP_009472038
Position
Unknown
AA seq 808 aa AA seqDB search
MGSYWSAHESEECPCCSLSVKIIRMRNLTKADMFSQTDCYVSLSLPTASPETVRTKTVKN
CKDPVWNETFCFRIQSQVKNILELKVYDENAITKDDLLFTVLFDVAKIQLGETVRLTFQL
NPKTQEMLEVEFALESIPVPPEKLVTNGVLVSREISCLEVLVDNRQMKKEPSEKDFLFTM
KGSYEESQTLSLRSPRQLAGPLDFHYIKYNLSELHMALAEKKPRFYLCTLGEEKKDCHAS
LTIPLDSLPFKEKVAVAKDETIDLHVKSNDWSRNLDVRLEFDLCMEEKNFLQKRRKFVAS
ALKKALHLEQDLQDHEVPVVAVMTTGGGTRALTSLLGNLLGLQKLGLLDAISYITGSSGS
TWTLSHLYQSTDWSRKDLSRLIGEVRKHMTKCKLSCFSLESLKYYDKELKLRKQEGYQIS
SIDFWGLLLEKALSDGKNNHKLSDERQALNQGQNPLPVYMILNIKEDYSLSEFKEWVEFT
PYEVGFLKYGAFIRAEDFGSKFFMGRLMKKLPESRICFMKGLWSNVFSYNLLDAWHSSDP
TGRCSLRCTQHRTVDVEGDEPSPPCRSHELETYLVTPECGIMGFIRQVLSERVMISKFYN
FLKGFQVHNEYLQSKSFYIWKDTVLENFPNQLTETAEFMCLADTAGYIDISYPPLMRPER
KVDVVLHLNYSSGSQTSPLEEASKYFLKQGIPFPKIHLSEEEKKNLKECYIFEDAETPEA
PTVVFFPLVNDTFRKYKEPGVERSPIEMAQGNVDVSSVFSPYCINTFTYTEEDFDKLVEL
TSYNIQNNKHLILQALSSAIEQKRQHKK
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgggatcatactggagtgctcatgagagtgaagaatgcccatgctgctcactctccgta
aaaatcataagaatgagaaatctgacaaaggcagatatgtttagtcaaactgattgctat
gtaagcctgtccttgcccactgcttcccctgagactgtccggaccaaaaccgtcaagaac
tgcaaagatccagtgtggaatgaaacattttgcttcaggatccagagccaagtaaaaaat
attcttgagctgaaagtctatgatgaaaatgcaatcactaaagatgacctcctcttcact
gtcctctttgatgttgctaaaatccagcttggagaaactgttcgcttgacttttcagtta
aatccaaagacacaagagatgctggaggttgagtttgcattggagagtattccagtccct
cctgaaaagctcgtcactaatggtgtattagtgtctcgtgaaatttcctgcttggaagtc
ctggtggacaatagacagatgaagaaagaaccttcagaaaaagactttttatttacaatg
aagggatcctacgaagagagccagaccctgtcactgcgctctccccggcaactcgcaggg
cccttggacttccattacatcaagtacaacctgtcagagctgcacatggctctagcagag
aagaagcctcgtttctacttgtgtaccttaggtgaagagaaaaaagactgccatgcatcc
ctcactattcctctggattcacttcccttcaaggagaaagtagcagtggcaaaggatgaa
acaattgatttacatgtgaagtcaaatgactggtcaagaaacttagatgttcgcttggag
tttgatctgtgtatggaggagaaaaatttcctacagaaacggaggaagtttgtggcttct
gctctgaaaaaagcacttcatttagagcaagacctacaagaccatgaggtaccagttgta
gcagtcatgacaacaggaggtggtacccgggcactgacatctctgttaggaaacctgttg
ggtcttcagaagctgggtctcttagatgctatttcatacatcactgggtcatctggttca
acatggaccttgtcacatttgtatcagagcactgactggtcacgcaaggatctgtctagg
ctgattggtgaagtccgcaaacatatgaccaagtgcaagctaagctgcttttccttggag
agcttgaagtactatgacaaggagctaaaactgcggaagcaagagggataccagatctct
agcattgatttttgggggcttctgctggaaaaagcattaagtgatgggaaaaacaaccac
aaactctcagatgagcgacaggcattgaatcagggccagaatcccctacctgtctacatg
atcctcaacatcaaagaagactacagcctttcagagttcaaagaatgggtggagttcacc
ccttatgaggtcggattcttaaaatacggtgccttcattcgtgcagaggattttggcagc
aagttcttcatgggccgtctgatgaagaagctccctgaatcccgcatctgtttcatgaaa
ggcctgtggagcaatgtcttttcctacaacctcttggatgcctggcattcatcagatcct
acaggaaggtgctcactgaggtgtactcaacacagaactgttgatgtcgaaggagatgag
ccttccccaccatgcaggagccatgagttggagacttacttagtcacccctgaatgtggc
atcatgggcttcattcggcaggtcctgtccgagcgggtgatgatttcaaagttctacaac
ttcctgaagggattccaggtgcacaatgaataccttcagagcaaaagcttctatatatgg
aaagatactgtactagagaatttccccaatcagctgacagaaacagcagagttcatgtgc
ctggcagacacagcgggatacatcgatatcagctacccaccgctcatgaggccagagagg
aaagtggatgttgtcctacacttaaactattcttctggatcacagacatcgcctttggaa
gaagcctccaagtacttcctaaagcagggaatcccatttcccaaaatccacctaagtgaa
gaagaaaagaaaaatctgaaggagtgctacatctttgaagacgcagagaccccagaggca
ccaacagtggtatttttcccactggtgaatgacaccttcagaaaatacaaagagcctggt
gtagagcgcagtcccattgagatggcacagggcaacgtggacgtttccagtgttttttcc
ccgtactgcataaacacctttacctacacagaggaggattttgacaagctggtagaactg
accagctacaacattcagaacaacaaacacctgatccttcaggctttgagttcagctata
gagcagaaacgacagcacaaaaaataa

DBGET integrated database retrieval system