KEGG   Nipponia nippon (crested ibis): 104020445Help
Entry
104020445         CDS       T05756                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00564  Glycerophospholipid metabolism
nni00565  Ether lipid metabolism
nni00590  Arachidonic acid metabolism
nni00591  Linoleic acid metabolism
nni00592  alpha-Linolenic acid metabolism
nni01100  Metabolic pathways
nni04010  MAPK signaling pathway
nni04217  Necroptosis
nni04270  Vascular smooth muscle contraction
nni04370  VEGF signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104020445 (PLA2G4B)
   00565 Ether lipid metabolism
    104020445 (PLA2G4B)
   00590 Arachidonic acid metabolism
    104020445 (PLA2G4B)
   00591 Linoleic acid metabolism
    104020445 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    104020445 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020445 (PLA2G4B)
   04370 VEGF signaling pathway
    104020445 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104020445 (PLA2G4B)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104020445 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104020445 (PLA2G4B)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104020445 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 104020445
NCBI-ProteinID: XP_009472150
Position
Unknown
AA seq 889 aa AA seqDB search
MGSPPAKMKFCPIHMLSVRIIQAKNIKSRDLWTVPLSCQNLAGQCYSLLDTSLKYLGISG
CSRNLQSSPDSSSEGHHLGDFLSHRCQASQMTASDCYVRLWLPSASNQKLQTKTIKNSDN
PVWNETFYFRIQREVENILELAVCDEDPLTKDDMQFTVLFNVARIRPGETIRETFALKSE
KERCTKKWESLEVEFWMERIPGPPEHLITNDVLVSREVCCLEVQVDINESRKYLKEGKNL
VLTVPASHEGTQKTTEDTDTFYFHCVKAWEPILRVRLQKVSDKEDDSSNLSDILTVPLKF
LPLGHKVKVTLPVRHNVPLQLYLQLNDCTEKLDVRFGYDLCREEQEFLQKRKRVVASALK
RVLHLERDLHGHEVPVIAVMATGGGLRAMSAMFGHLLALQKLNLLDSVTYLTGASGSTWT
LADLYEHADWSQQTLEGPLKAVKEQVTKCKLNLMSIEHLKYYHKELAERAKAGHVSSFTT
LWSLVQEMFLHERPRKYKLTDQRKALEHGQNPLPFYAVLNVKEEKFSTFKFREWAEFSPY
EVAIPKYGASIRSEYFDSEFFMGRRVKKLPESRICYLEGLWTNIFTRNLLDGLYWSSNSN
EFWERWGKDMVDIEKHSPEDDVTVIEPPSCLSGKLYEMFQDIMTKRPLLGKSHNFLRGLE
FHKDYIHQKKFIEWKDRITDSSFPTNAPLTVFKMFFFPNNLTPLQKYLCLIDVGYFINTS
GAALFKPERNVDVIISLDYGLGNVFKQLEMTYKYCKIQKIPFPKVELSKEEEKNPKECYV
FSDAEDPRAPIVIHFPLVNDTFKEFKEPGVKRCLSEMEEGKVNLDSNCSPYYLIRLIYSS
ENFDKLVNLSKYNILNNKDLLLQAIRSAVERRRSSRTGNLPSHSGAGYP
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggggagcccaccagccaagatgaagttttgccccatccacatgctttctgtaagaatc
atacaagccaagaacatcaagtcaagagacctgtggacagttccactttcctgccaaaac
cttgcgggccaatgttattcactgcttgataccagtctgaagtatttaggcatctcgggc
tgcagtagaaatcttcagtcaagtccagactccagctctgaaggacatcaccttggagat
ttcctttcacaccgttgtcaagcttcacaaatgactgcatcagactgctatgtgcgcttg
tggctgccatctgcttcaaatcaaaagcttcagaccaaaaccatcaagaattctgacaac
cctgtctggaatgagactttctactttaggatccagagagaagttgagaacattttagaa
ttggcagtgtgtgatgaagatccactcaccaaagatgacatgcagttcacagttcttttt
aatgttgctagaatcagacccggagagacaatccgtgagacatttgctttgaaatcagag
aaggagagatgcactaagaaatgggaaagtttggaagtggaattctggatggaaagaatt
cctggccctccagagcacctcattaccaatgatgtcctagtgtctcgtgaggtttgctgt
ttggaagtgcaagtggacattaatgaaagcaggaaatatttgaaagagggtaaaaatctt
gtgcttacggtgcctgcatctcatgagggaacacagaaaactacagaggacacagatact
ttctacttccattgtgtgaaggcttgggaaccaattctaagagtcaggctacagaaagtt
tctgataaggaagatgacagtagcaatttaagtgacatcttaacagtaccactgaaattt
cttcctcttggacataaagtgaaagtaaccctccctgtaagacataatgtgccactgcaa
ttgtacctccagctaaatgattgcacagaaaaactagatgtgcgcttcgggtacgatctt
tgccgagaagagcaagaattcttgcaaaaaaggaagagagtggttgccagtgccctgaaa
agggttcttcatctggaaagagatctacatggacacgaggtgccggtaatagctgttatg
gcaacaggtggaggcctcagagcaatgtcagctatgtttggccacctcttagctcttcag
aagctaaatctgttggactctgttacctatctcaccggggcttctggctcgacatggacc
ctagcagacctgtatgagcatgccgactggtcacagcagactctggaggggccacttaag
gcagtgaaagaacaagtgaccaaatgcaagctcaaccttatgtctatagagcatctgaag
tactatcacaaggaactcgctgaaagggcaaaagcaggacatgtgtcatcttttacaact
ctgtggtcacttgttcaggaaatgttcttacatgaacggccaagaaagtacaaactcaca
gaccagcgcaaggcattggagcatggacaaaacccattgcctttctatgcagtccttaat
gtgaaagaggaaaagttcagtactttcaaatttagagagtgggcggagttctctccttat
gaggtggccataccaaaatatggagcctccattcgttcagaatattttgacagtgagttc
ttcatgggaaggcgagtgaagaagctgccagaatctcggatctgctatctggaaggtctt
tggacaaacatctttactaggaatttgctggatggcttgtactggtcttcaaattcaaat
gagttctgggaacgatggggcaaagatatggtagatatagaaaaacattcccctgaggat
gatgtcactgtcatcgagcctccgtcttgtttgtcagggaagttgtatgaaatgtttcag
gacattatgaccaaacgtccactactgggaaagtctcataacttcctgagaggcttagaa
tttcataaggattatatccatcagaaaaaatttattgaatggaaagacagaattactgac
tcctcctttcctaccaatgcaccactaactgtattcaaaatgttttttttccctaacaat
ctgacgccgctgcagaaatatctttgcctgatagatgttggctatttcatcaacaccagt
ggtgcagcacttttcaagccagagaggaatgtagatgtcattatctcactcgattatggt
ttggggaatgtgttcaagcaattagagatgacgtacaaatattgcaagatacaaaaaatc
ccattccctaaagtggagctaagtaaagaagaagagaagaacccaaaggaatgttacgtg
ttttcggatgcagaggaccccagagcacccatagtaatccatttccccctggtgaatgac
acctttaaggaattcaaggagcccggggtaaagcgctgtctctcagagatggaggaaggc
aaagtaaatctggacagcaactgctcaccttattacctcattaggctaatctactcctct
gaaaattttgacaaactcgtgaacctgagcaaatacaacatcctcaataacaaagacctg
ctcctccaggcaatccggagtgccgtagaacggaggagaagcagcaggactgggaatctc
cccagccactctggagctggatacccctag

DBGET integrated database retrieval system