KEGG   Nipponia nippon (crested ibis): 104021123Help
Entry
104021123         CDS       T05756                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00450  Selenocompound metabolism
nni00970  Aminoacyl-tRNA biosynthesis
nni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104021123 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104021123 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nni01007]
    104021123 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nni03016]
    104021123 (MARS2)
Enzymes [BR:nni01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104021123 (MARS2)
Amino acid related enzymes [BR:nni01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104021123 (MARS2)
Transfer RNA biogenesis [BR:nni03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104021123 (MARS2)
 Prokaryotic type
   Other AARSs
    104021123 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 104021123
NCBI-ProteinID: XP_009472891
Position
Unknown
AA seq 505 aa AA seqDB search
MGTDEHGLKIQQAAAAAGTSPPELCERISGLFHRALTQAAVSFTDFTRTSEPRHQRAVRH
FWGALRDRGALYKGCYEGWYCTAEECFVPEGQLGERPDAQDRPGKVSLETGHQVHWTKEE
NYMFRLSAFRDPLQKWLRDNPHAISPEPFYQRVLRWLEEDLPDLSVSRERSRLQWGIPVP
SDPTQTIYVWVDALVNYLSVVGYPETHGEWWPAAHHVVGKDILKFHAIYWPALLMAAGLA
PPERIFVHSHWTVRGQKMSKSLGNVIDPVACIGEYTVDGFRYFLLRQGVPERDCDYYDEK
VVKLVNSELADALGGLLNRSTALSINPSNTYPCFSESCFPKILDYRGTKAVGRASAEDYE
FVASVASLPLQVASYFEGFQIYKALECVALCVRQTNSFFQRHKPWKLNQKDPAEKLWLDT
ILHVTLECLRVYGTLLQPVIPHAADKLLSRLAVEPEERGLSGLTFLPRYDGKPCPFEGRQ
LGPDTGVLFHRLEKSRQHQTETKQL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgatgagcacgggctgaagatccagcaggccgcggccgcggcggggacgtcg
cccccggagctctgcgagcggatctcgggcctcttccaccgggccttgacccaggccgcc
gtctccttcaccgacttcacccgcaccagcgagccgcgccaccagcgagccgtgcgacac
ttctggggcgccctccgggaccgcggggctctctacaaagggtgttacgagggctggtac
tgcactgccgaggagtgcttcgtgcccgagggccagctcggcgagcggccggacgcccag
gaccgccccggcaaggtgtcgctggagaccggccaccaggtgcactggaccaaagaggag
aattacatgttcaggctctcggcgttccgggatccgttgcagaagtggctccgggacaac
ccgcacgccatttcccctgagcctttctaccagcgcgtgctccgctggctggaagaggac
ttgccagacttgtccgtctctcgtgagagaagccggctgcagtggggtatccctgttccc
agtgacccaacacaaacgatttacgtttgggtggatgccttggtgaactacctgagcgtg
gtgggctaccccgagacgcacggtgagtggtggcccgctgcgcaccacgttgtgggcaag
gacatcctcaagtttcatgccatctactggccagcgctgctgatggcagcggggctggct
ccccccgagcgaatctttgtgcactcccactggactgtccgtgggcagaagatgtccaaa
agcctgggcaacgtgattgaccccgttgcttgtattggagagtacacagtagatggattt
cggtacttcctgctaaggcagggcgtacctgagcgggattgtgactattatgatgagaag
gttgttaagctggtgaattcggaactggcagatgctcttggggggctcctgaatcggtcg
acagccctcagcattaaccccagcaacacctacccttgtttctcagagtcttgttttcca
aagatcttggattacagggggacgaaagccgtgggtagggcttctgccgaagactatgag
ttcgtggcatctgtggcttctctgcctctgcaggtggctagttattttgaaggtttccag
atctacaaggctttagaatgtgttgccctgtgcgtaaggcagaccaacagtttcttccag
agacacaagccttggaaactcaaccaaaaagaccctgcggagaagctctggcttgacacc
atcctccacgttacgctggaatgcctgcgcgtctacgggaccctcctgcagcccgtgatc
ccacacgctgcagacaagttgctttccaggctggccgttgagccagaagagagaggtctc
tcaggtttgacatttctgccacgctacgacgggaagccgtgtccctttgaagggaggcag
cttggacctgacaccggcgtcttatttcacagactagagaagtcaagacagcatcaaaca
gaaaccaaacagctctag

DBGET integrated database retrieval system