KEGG   Nocardia nova: NONO_c14790Help
Entry
NONO_c14790       CDS       T03032                                 

Gene name
purA1
Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
nno  Nocardia nova
Pathway
nno00230  Purine metabolism
nno00250  Alanine, aspartate and glutamate metabolism
nno01100  Metabolic pathways
Module
nno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NONO_c14790 (purA1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NONO_c14790 (purA1)
Enzymes [BR:nno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     NONO_c14790 (purA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHH16282
UniProt: W5TAP8
Position
1639418..1640680
Genome map
AA seq 420 aa AA seqDB search
MFGDRHVIVVDLGFGDAGKGATVDWLCSPGAGLDVSAVVRFNGGAQAAHTVVDGARRHTF
RQFGSGTLSGVPTLLSRYALVDPIALAAEARALAVLGVRDPLDLLFVDERALLTTPIHGA
ANRCREDARGAARHGSCGMGIGETASYALEHDAPRIRDCRNPDVLRRKLIALEQHYAPLL
ATGRHRHDPVDELVAAYTEFARAVAVVPGGQLAVLARAGRLVFEGAQGVLLDEWRGLHPY
TTWSTVEPRRARALLAGIGESGAVLGVTRAYQTRHGAGPFPTEDAALAIPEPDNATGRYQ
GAFRVGHLDPILLRYAVDVCDGVDALAVNHLDILTGRDDIRTAAGYFTPDGYRDRLDCGP
WRDLEYQRLLTDLVAASTPDLVPLPVDVPDFLAGRLRAPVVLTGHGPDRADRRARVAAAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcgaccggcacgtgatcgtggtcgatctgggattcggcgacgccggtaagggc
gccacggtggactggctgtgctcgccgggggccggactggacgtctcggcggtggtgcgg
ttcaacgggggcgcccaggccgcgcacaccgtggtcgacggcgcacggaggcacaccttc
cggcaattcggctcgggcacgttgtcgggtgtgccgacgctgttgtcgcggtatgcgctg
gtggatccgatcgcgctggccgccgaggcccgggcgctggccgtgctcggtgtcagggat
ccgctggatctgctgttcgtcgacgagcgggccctgctcaccaccccgatccacggggcc
gccaaccgttgccgggaggatgcgcggggtgccgcccggcacggttcgtgcggtatggga
atcggcgagaccgcgagctacgcccttgagcacgacgcaccgcgaatccgggactgccgg
aatccggatgtgctgcgccgcaagctgatcgccctcgagcagcactatgcgccgctgctc
gcgaccggccggcaccgccacgatccggtggacgaactcgtggccgcctacaccgaattc
gcgcgggccgtggcggtggtgccgggtgggcagctcgcggttctcgcgcgggccggacgg
ctggtgttcgagggcgcgcagggtgtgttgctcgacgagtggcgcggtctgcacccctac
accacctggtcgacggtggagccgcgccgggcccgcgccctgctggccgggatcggcgaa
tccggtgcggtactgggtgtgacgcgcgcgtaccagacccgccacggcgccgggcccttc
ccgaccgaggacgcggccctcgcgattccggagcccgacaacgcgaccgggcgctaccag
ggggcgttccgggtggggcacctcgacccgatcctgctgcgctatgccgtggacgtgtgc
gacggggtggacgcgctggccgtcaaccacctcgacatcctcaccggccgcgacgacatc
cgcaccgccgcagggtatttcaccccagacggctaccgggaccggctcgattgcgggccg
tggcgggacctggagtatcagcgactgctcacggatctggtcgcggcgagtacgcccgat
ctggtaccgctgccggtggacgtgccggatttcctggccgggcgactgcgggcgccggtg
gtgctgaccgggcacggacccgaccgagccgaccggcgggcccgggtcgcggctgcggca
tga

DBGET integrated database retrieval system