KEGG   Nocardia nova: NONO_c27860Help
Entry
NONO_c27860       CDS       T03032                                 

Definition
(GenBank) alcohol dehydrogenase-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nno  Nocardia nova
Pathway
nno00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NONO_c27860
Enzymes [BR:nno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NONO_c27860
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NONO_c27860
    1.1.1.-  
     NONO_c27860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD ADH_zinc_N_2 ADH_N_assoc DUF2367 Urocanase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHH17578
UniProt: W5TEZ5
Position
complement(3046974..3048038)
Genome map
AA seq 354 aa AA seqDB search
MKAVRYYGKGDVRFEDGVPEPELRPGTVMVAPAWTGLCGSDLHLYFEGPIPPAPPSTTEA
HPLTGETLPIIMGHEFSGVVERIGEGVTGFVVGESVVVEPLVTCGHCPACRSGRYNDCET
MACLGISGGGGGLSEHVVVAADRVHPVGDVPLDEAALIEPLCVAYHGVRQSGAKAGDIAV
VGGAGPVGVLAAAALKGVGATTIVSEISAIRRQTAIATGVADYVVNPLEESLQDKVAEIT
GGNGADVAFDCAGVEVVLDQLMDVLKVGGILEMIGIYPSKPQIDMVKLVFKEISIQGSVG
YAGDHAAVIELVRDGKINLKPFITARIQADDFVEGGLKYLEKDKDSQVKMIVRL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgtgcgctactacggcaagggcgacgtccgcttcgaggacggggtgcccgaa
cccgagctgcgaccggggacggtgatggtcgcccccgcctggaccggcctgtgcgggtcg
gacctgcacctctacttcgaaggcccgattccgcccgccccgccgagcacgaccgaggcc
catcccctgaccggtgagaccctgcccatcatcatgggccacgagttctccggcgtggtc
gagcggatcggcgagggcgtcaccggcttcgtcgtcggcgagagcgtggtcgtggaaccg
ctggtcacctgcggtcactgtccggcctgccgctcgggccggtacaacgactgcgagacg
atggcctgcctcgggatctccggaggcggcggcgggctgtccgaacacgtcgtcgtcgcg
gccgaccgcgtacacccggtcggcgatgttcctctcgacgaggccgcgctgatcgagccg
ctgtgcgtggcctaccacggggtgcggcagtccggcgccaaggccggtgacatcgccgtc
gtcggcggcgccgggccggtcggggtgctggcggccgcggcactgaagggcgtgggagcc
acgaccatcgtcagcgagatctccgcgatccggcgccagaccgccatcgccaccggcgtc
gccgattacgtggtcaacccgctcgaggagtcgctgcaggacaaggtcgccgagatcacc
ggcggcaacggcgcggacgtcgcattcgactgcgccggtgtcgaggtcgtgctggatcag
ctgatggatgtgctcaaggtcggcggcatcctggagatgatcggcatctatccgagcaag
ccgcagatcgacatggtcaagctggtcttcaaggagatctcgatccaggggtcggtcggc
tatgccggcgaccacgccgccgtcatcgagctggtgcgcgacggcaagatcaacctcaag
cccttcatcaccgcccggatccaggccgacgacttcgtcgaaggcgggctgaagtacctg
gagaaggacaaggactcacaggtcaagatgatcgtgcggctctga

DBGET integrated database retrieval system