KEGG   Nocardia nova: NONO_c28470Help
Entry
NONO_c28470       CDS       T03032                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nno  Nocardia nova
Pathway
nno00071  Fatty acid degradation
nno00072  Synthesis and degradation of ketone bodies
nno00280  Valine, leucine and isoleucine degradation
nno00310  Lysine degradation
nno00362  Benzoate degradation
nno00380  Tryptophan metabolism
nno00620  Pyruvate metabolism
nno00630  Glyoxylate and dicarboxylate metabolism
nno00640  Propanoate metabolism
nno00650  Butanoate metabolism
nno00900  Terpenoid backbone biosynthesis
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
nno01120  Microbial metabolism in diverse environments
nno01130  Biosynthesis of antibiotics
nno01200  Carbon metabolism
nno01212  Fatty acid metabolism
nno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NONO_c28470 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    NONO_c28470 (phbA)
   00640 Propanoate metabolism
    NONO_c28470 (phbA)
   00650 Butanoate metabolism
    NONO_c28470 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NONO_c28470 (phbA)
   00072 Synthesis and degradation of ketone bodies
    NONO_c28470 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NONO_c28470 (phbA)
   00310 Lysine degradation
    NONO_c28470 (phbA)
   00380 Tryptophan metabolism
    NONO_c28470 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NONO_c28470 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NONO_c28470 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NONO_c28470 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nno04147]
    NONO_c28470 (phbA)
Enzymes [BR:nno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NONO_c28470 (phbA)
Exosome [BR:nno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NONO_c28470 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHH17639
UniProt: W5TEP8
Position
3113336..3114562
Genome map
AA seq 408 aa AA seqDB search
MSKQQYVRRVAIVDPLRTPVGTFGGALRDVAVEDLAATVVREVVARSGVDPERIDDVVFA
QSYANSEVPCVGRWVALHAGLPIGVPGMQLDRRCGGGLQALVTAAMMVQTGAADVVLAGG
VESMSRIEYYSTATRWGARAGTVSLYDRLDRGRERSQPEERFGKISGMIETAENLASDYK
IDRDSADAYAARSHQRAAAAWKDGRFDDEVVPVSVPQRRGEPRIFAADEGVRPDSTAETL
AKLRSIQPGGTVTAGNASQQNDAASACLVVAEDRLAELGLTPIGYFDAWAAAGCDPSRMG
IGPVPAVAKLAARQGLDTLQLLDGLDLVELNEAFAVQVLAVLEGWGWLDHDRLNVNGSGI
SLGHPIGATGLRMVTTLLHELHRRGGGKGLATMCIGGGQGLAATVEAV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaacagcaatatgtgcggcgagtcgcgatcgtggatccgctgcggactcccgtc
gggaccttcggcggggccctgcgcgatgtcgcggtggaggatctggcggcgaccgtggtc
cgggaggtggtcgcgcgctcgggcgtggaccccgagcgcatcgacgacgtggtgttcgcg
cagtcctacgccaactcggaggtgccgtgcgtgggccgctgggtggcgctgcacgccgga
ttgccgatcggggtccccggcatgcagctggatcggcgctgcggcggtggcctgcaggcg
ctggtgaccgcggcgatgatggtgcagaccggcgccgccgatgtggtgctcgcgggcggc
gtggaatccatgagccgcatcgagtactactcgaccgcgacccgctggggtgcgcgggcg
ggcacggtctcgctctacgaccggctcgaccggggacgggagcggtcgcagccggaggaa
cggttcgggaagatctccgggatgatcgagaccgccgagaacctggcgagcgactacaag
atcgaccgggacagcgccgacgcctatgccgcgcgcagtcatcagcgtgccgcggcggcg
tggaaggacggccgtttcgacgacgaggtggtgccggtctcggtgccgcagcggcggggc
gagccgcggatcttcgccgccgacgagggggtgcggcccgacagcacggccgaaaccctg
gccaagctgcgctcgatccagcccggcggcacggtgacggccggaaacgccagtcagcag
aacgacgccgcctcggcgtgcctggtggtggccgaggaccgtctcgccgagctcgggctg
acgccgatcggatatttcgacgcctgggcggcggcggggtgcgatccgtcgcggatgggg
atcggcccggtgcccgcggtcgcgaaactcgctgcgcgccaaggtctcgacacgctgcag
ttgctggacggcctcgatctggtcgagttgaacgaggcgttcgccgtgcaggtgctcgcg
gtgctggaggggtggggctggctcgatcacgatcggctcaacgtcaacggttccggcatc
tcgctcggacatccgatcggggcgacgggtctgcgcatggtgaccactctgctccacgaa
ctgcatcgccgcggcggcgggaaggggctcgccaccatgtgcatcggcggtggtcagggt
cttgccgccacggtggaggcggtgtag

DBGET integrated database retrieval system