KEGG   Nocardia nova: NONO_c32630Help
Entry
NONO_c32630       CDS       T03032                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
nno  Nocardia nova
Pathway
nno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NONO_c32630 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nno03400]
    NONO_c32630 (recB)
Enzymes [BR:nno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NONO_c32630 (recB)
DNA repair and recombination proteins [BR:nno03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NONO_c32630 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C PDDEXK_1 UvrD_C_2 AAA_30 PhoH
Motif
Other DBs
NCBI-ProteinID: AHH18050
UniProt: W5TFC1
Position
3551482..3554922
Genome map
AA seq 1146 aa AA seqDB search
MTDELFPTGDVRTVDDRPRPRRRARPTGESAAGRFATGGEAGPRRDSSEFDLCGELPTGT
TILEASAGTGKTYAIVGLAVRFVAEGVVDISQLLLVTFSRAATQELRERTRDRFVAVAAA
LAEPATARSADDELIVHLAAADDAEVLRRRARLVAALSDFDAGTISTTHGFCQRMLDELG
IAGEHDPRVRLVEGIEDLVTTVAEDLYLARYARGGAPMPIRQATALAKAAVADRRARLVP
GDELGDHPAAEAAAFAAAVRTEVERRKRLSGLRDYDDQLVLLHDVLADPAHGERACRRIR
ERFPVTLVDEFQDTDPLQWDILRRVFHTHTTLVLVGDPKQAIYAFRGAEVLSYLDAVALA
GARRELDINRRSDAGLLTALHHVFGGAALGHPEITVPPVRAVRPHTRLSGPGDSPVPLRL
RLFPRQGAGALNGSGFPAVGRQRERVADDVAADIVRTLESGLRVDGAALGPGDIAVLVRK
RTQIDAVRAALDRAGVASVLAGGASVFGTRSATDWLWVLRALEQPHRGDRVRLAATTPLL
GYSAAEIDSGGADLVGQIGTRLREAARLFARSGFAAVFDRLGAQALPAPRLLSVLGGERR
LTDLRHIAQLLDEVASRESLGLTALTRWLADRVRDPESGAVSGRSRRLDRDAAAVQIATV
HASKGLEFPIVYLPFAWDSAKIPDPPTLLFHDGPDRVLDVGGPEAPGYAEHKRRCDAEEA
GEELRLLYVALTRAKCRVVAWWAPTYGTASAPLHRMILGRDPGSAEVPARSEVAADPIAL
RRLQDWAAAAGPGLIDIEPIRAPEQLRLRTERGRDGDVHLAAARFERTVDHEWRRTSYSA
LTASAHEQAPAALDTAETVSGGTDEPLSPAPELETDPGAEFAGAAPSLMNGLPYGAEFGT
LVHGVLELVDTDAPDLAAEVRARCAHAVAELMADIDPDELARALVAVLRTSVDPVALADI
RSRDRLEELEFELPLAGGDDPVARRVSVRRIADLLRAHLPADDPFAEYAAAVELLDDIAL
KGFLTGSIDAVLRTAGPRFVVVDYKTNRLGSGDLTVAHYTRDRMAQEMARSHYPLQALLY
SAALHRYLRWRMPDYDPARHLGGVRYLFVRGMIGPDTPPGHGVFDWDPPVDLVVALSDLL
AGGRTR
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaactgttcccgaccggcgatgtgcgcaccgtcgacgaccgcccgcggcca
cgtcggcgcgcacgacccacgggcgaatccgccgccggacggttcgccaccggcggggaa
gcgggcccccggcgcgattcgtccgaattcgatctgtgcggcgaattgcccaccggcaca
accatcctggaggccagcgccggaaccgggaagacctatgccatcgtcgggctggcggtg
cgtttcgtcgccgagggtgtcgtggacatctcccagctgctgctggtgaccttcagccgg
gccgcgacccaggaactgcgcgagcgcacccgcgaccgtttcgtcgcggtcgccgccgca
ctcgccgaaccggccaccgcccggtcggccgacgacgagctgatcgtccatctggccgcg
gccgacgacgccgaggtgctgcggcggcgcgcccggctggtggcagcactgtcggatttc
gacgccggaaccatttccacgactcacgggttctgccagcgcatgctcgacgaactcggc
atcgcgggcgagcacgatccgcgggtgcggctggtggagggaatcgaggacctggtgacc
acggtcgccgaggatctgtatctggcccgctacgcccgcggcggcgcgccgatgccgatc
cggcaggccacggcactggcgaaagcggcggtcgccgatcgtcgcgcgcgactggtgccc
ggcgacgaactcggcgatcacccggcggccgaagcggcggccttcgcggccgcggtccgc
acggaagtggaacggcgcaaacggctttcgggcctgcgcgactacgacgaccaactggtc
ctgctgcacgacgtcctcgccgatcccgcccacggcgagcgagcctgccgccgcatccgc
gagcgcttcccggtgaccctggtggacgaattccaggacaccgatccgctgcagtgggac
atcctgcggcgggtgttccacacccacaccaccctcgtcctggtcggcgatcccaaacag
gcgatctacgccttccggggcgccgaggtgctgagctatctggacgcggtcgcgctggcg
ggtgcgcgccgcgaactcgacatcaaccggcgcagcgatgccggactgctgacggcgctg
caccacgtattcggcggtgcggcgctgggacatccggagatcaccgtgccgccggtgcgc
gcggtgcgcccgcacacccggttgagcggaccgggtgactcgccggttccgttgcggctc
aggttgtttccgcgtcagggcgcgggtgcgctcaacggcagcgggtttcccgcggtgggg
cgccagcgggaacgggtcgccgacgatgtggccgccgacatcgtgcgcaccctcgaatcc
ggtctgcgcgtcgacggcgcggcgctcgggcccggtgatatcgcggtcctggtgcgcaaa
cgcacccagatcgacgcggtgcgcgccgcgctggaccgggccggggtggcgtcggtgctg
gccggtggtgcgagtgtgttcggcacccgcagcgccaccgactggctgtgggtgctgcgg
gcgctggaacaaccacatcgcggcgaccgggtgcggctggcggcgaccactccgctgctg
ggctactcggccgccgagatcgactccggcggtgcggatctggtcgggcagatcggcacc
cggctgcgcgaggccgcccggttgttcgcgcgctcgggattcgcggcggtcttcgaccgg
ctcggtgcgcaggcgctcccggcgccgcgcctgctgagcgttctcggcggtgagcggcgg
ctgaccgatctgcgtcatatcgcgcagctgctcgacgaggtggcgagccgggaatcgctg
gggctcaccgcgctgacccgctggctggccgaccgggtccgggatccggagtcgggcgcg
gtctccgggcgcagccgccgcctcgaccgcgatgccgccgcggtgcagatcgcgaccgtc
cacgccagcaagggactggaattcccgatcgtctacctgccgttcgcctgggacagcgcg
aagattccggacccgccgaccctgctgttccacgacggccccgaccgggtgctcgatgtg
ggcggccccgaggcgcccggatacgccgaacacaaacgccgatgcgacgccgaggaggcc
ggtgaggaactgcggctgctgtatgtcgcgctgacccgggcgaaatgccgggtggtcgcc
tggtgggcccccacctacggcaccgcgtccgccccgctgcaccggatgatcctgggccgc
gacccgggcagcgcggaggtgcccgcgcgcagcgaggtcgccgccgatccgatcgcgttg
cgccggctacaggactgggccgccgcggccggtcccggactgatcgacatcgaaccgatc
cgtgcccccgaacaactgcggctgcgcaccgagcgtggccgcgacggcgacgtacacttg
gccgccgcgcgattcgagcgcaccgtggaccacgaatggcgccgcacctcctattcggcg
ctgacggcctcggcgcacgagcaggcgcccgccgcactcgacaccgcggaaacggtgtcc
ggcggtaccgacgaacctctttctcccgcaccggaactcgagaccgatccgggcgcggaa
ttcgccggagccgcaccgtcgctgatgaacggcctgccctacggcgccgaattcggcacc
ctcgtccacggcgtcctcgaactggtcgacaccgacgcgccggatctcgccgcggaggtg
cgcgcgcgatgcgcgcacgcggtcgcggaactgatggccgacatcgatcccgacgaactc
gcccgcgcgctggtcgcggtgctgcgcacctcggtggacccggtcgcgctcgccgacatc
cggtcccgcgaccggctcgaggagctggaattcgaactgccgctcgcgggcggtgacgac
ccggtggcgcgacgggtgagcgtgcgccgtatcgccgatctgctgcgcgcccatctgccc
gccgacgatccgttcgccgagtacgccgcggcggtggaactgctcgacgacatcgcgctg
aagggcttcctcaccggcagtatcgacgccgtattgcgcacggccgggccacgtttcgtg
gtcgtggactacaagaccaaccggctgggttccggtgatctgaccgtcgcccattacacc
cgcgaccggatggcgcaggagatggcgcgctcgcactacccgctgcaggcgctgttgtat
tccgccgcgctgcaccggtatctgcgctggcggatgcccgattacgatccggcccggcat
ctgggcggggtgcgctacctgttcgtgcgcggcatgatcggcccggacacaccgcccggt
cacggcgtcttcgactgggatccgccggtggacctggtggtggcgctgtcggatctgctg
gcgggcgggaggacccgatga

DBGET integrated database retrieval system