KEGG   Nocardia nova: NONO_c38580Help
Entry
NONO_c38580       CDS       T03032                                 

Definition
(GenBank) putative geranylgeranyl pyrophosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
nno  Nocardia nova
Pathway
nno00900  Terpenoid backbone biosynthesis
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
Module
nno_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NONO_c38580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nno01006]
    NONO_c38580
Enzymes [BR:nno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NONO_c38580
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NONO_c38580
    2.5.1.29  geranylgeranyl diphosphate synthase
     NONO_c38580
Prenyltransferases [BR:nno01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NONO_c38580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AHH18642
UniProt: W5THE7
Position
complement(4255781..4256902)
Genome map
AA seq 373 aa AA seqDB search
MSVAAFDRSSDSELELPLAPKGPDVPVNRWRSAVRTQVLSELNAFLDDNHIDPIRGIAVD
DIARHYLSGGKCLRSSFMYLGWLCGAAPSPAAVRAAAALELVHAFALIQDDVMDGSDLRR
GRPAAHIRFAAEHRDRALPGSASRFGESAATLLGDICLVWSEKMLRDSGIEQPALDRLWP
RYDSMRVELALGQFADLLNDARSEPTLGPVLAIARAKSGNYTVRRPLEMGAAMAGCDDRT
LAALGRYGDAVGEAFQLRDDLLGVFGAAEITGKPGDTDLGQRKATTVVVAAAQLADTRTR
RELTELLAAPSADAATLARLRTLIAATGAPACIETMIANRIAEARRVLDVIPLPDTQRHL
LYGMALICTARHS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgccgcattcgatcgatcatcggattccgagctcgagcttccccttgccccg
aaggggcccgacgtaccggtcaaccggtggcgatccgccgtgcggacgcaggtgttgtcg
gagctgaacgctttcctcgacgacaaccacatcgacccgatccgcggtatcgccgtcgac
gacatcgcacggcactatctgagcggagggaagtgcctgcgctcgtcgttcatgtatctg
gggtggctgtgcggggccgccccgagccccgcggccgtgcgtgctgccgcggcgctggag
ctggtgcacgccttcgcgctgatccaggacgatgtcatggacgggtccgacctgcgtcgt
ggccgccccgccgcccacatccggttcgccgcggagcatcgcgaccgcgccctccccggt
tcggcctcgagattcggcgagtccgcggccactctgctcggtgacatctgcctggtgtgg
tcggaaaagatgctgcgcgacagcgggatcgagcaaccggccctcgatcggctgtggccc
cgctacgacagcatgcgcgtcgagttggcgctcgggcaattcgccgatctgctcaacgac
gcccgatccgagccgacgctgggcccggtgctcgccatcgcgcgggcgaagtcgggcaac
tacaccgtgcgacgaccattggagatgggcgccgccatggccggttgcgacgatcgcacc
ctggccgcgctgggccgctacggtgacgccgtcggtgaggcgttccagctgcgcgacgat
ctcctgggagtcttcggcgccgccgagatcaccggtaaacccggcgataccgacctcggg
caacgcaaggccaccaccgtggtcgtcgccgccgcgcaactggccgacacccgcactcgg
cgcgaactgaccgaactgctggccgcgccgtccgccgacgcggccacgcttgctcggctc
cgcacgctcatcgccgcaaccggcgcacccgcgtgcatcgagacgatgatcgccaaccgg
atcgccgaggcacgccgtgttctcgacgtgatcccgctgccggacacgcagcgtcacctg
ctctacggcatggccctgatctgtaccgcccgccacagctga

DBGET integrated database retrieval system