KEGG   Nocardia nova: NONO_c55280Help
Entry
NONO_c55280       CDS       T03032                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nno  Nocardia nova
Pathway
nno00860  Porphyrin and chlorophyll metabolism
nno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NONO_c55280 (cobQ)
Enzymes [BR:nno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     NONO_c55280 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase DJ-1_PfpI Peptidase_C26 CTP_synth_N
Motif
Other DBs
NCBI-ProteinID: AHH20308
UniProt: W5TMU4
Position
complement(6033146..6034696)
Genome map
AA seq 516 aa AA seqDB search
MKGALLIAGTTSDAGKSVVAAGICRMLARRGVRVAPFKAQNMSNNSVVTLDGGEIGRAQA
LQARACRLEPSVRFNPVLLKPGSDRRSQLVVRGVAVDTVGARDYFRHRQRLREVVAAELS
ALRAEFDVVICEGAGSPAEINLRATDLANMGLARAADLPVLLVGDIDRGGVLAHLFGTVA
ILEPEDQQLISGFIVNKFRGDVELLRPGLEQLTTLTGRPTLGVLPYTDELWLDAEDSLGT
VADAPVGRPRPPVGAEWLTVAAIRLPRISNSTDIEALACEPGVSVRWVSEPSRLAGADIV
VLPGSKSTVSDLNWLRRSGIAAAVAAHAAAGKPVLGICGGYQMLGRRIDDEVESAAGAVD
GLGLLDLEIEFAEPKVLRRTTGRGASAEVAGIPLSGYEIHHGRVRRNGDPAWAELDGGAP
EGSVRGSVRGTHLHGLLESDDFRRAWLREAAVQAGRTGFRAAPATSVEEVRGAQLDLLAD
LIESHLDIGELERLIVAGAPRDLPVLTVGCSETDAR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggcgcgctgctgatcgcgggcaccacctccgatgcgggtaagagcgtcgtggcg
gccgggatctgccggatgctggcgcggcgcggggtgcgggtggcgccgttcaaggcgcag
aacatgtccaacaactccgtggtgaccctcgacggcggcgagatcggccgggcccaggcg
ctgcaggcgcgggcctgccggctggaaccgagtgtgcggttcaatccggtgctgctcaaa
cccggcagcgaccggcgctcacagctggtggtgcggggtgtggccgtcgataccgtgggc
gcgcgcgactacttccggcaccggcagcggctgcgcgaggtggtggcggccgaattgtcc
gcgttgcgcgccgaattcgatgtggtgatctgcgagggcgccggttcaccggccgaaatc
aatctgcgggcgacggatctggcgaatatgggactggcccgggccgcggatctgccggtg
ctgctggtcggtgatatcgaccgcggcggggtgctggcccatcttttcggcaccgtcgcg
attctggaacccgaagaccagcaactgatttcgggcttcatcgtcaacaagttccgtggc
gatgtcgagctgctgcggcccggactcgagcagctcacgactctcacgggccgtccgacg
ctgggggtgctgccctacaccgacgaactgtggctcgacgcggaggactctctcggcacg
gtcgccgacgcgccggtcggccgtccccgtccgcccgtcggcgccgaatggctgaccgtc
gccgcgatccggctcccgcgcatctccaactccaccgatatcgaggcgctggcctgtgag
ccgggcgtctcggtgcgctgggtgagcgagccctcccggctggccggcgccgacatcgtc
gtgctgcccggcagcaagtccaccgtctcggatctgaactggctgcgccgcagcggaatc
gcggccgccgtcgccgcgcacgccgccgccggtaagccggtgctcgggatctgcggcggc
tatcagatgctcggacgtcgcatcgacgacgaggtggaatcggcggccggggccgtggac
gggctcggcctgctggatctcgagatcgaattcgccgagccgaaggtcctgcgccgcacc
accggtcgcggtgcgtcggcagaggtcgccggaatcccgctgtcgggatacgagattcat
cacggccgggtgcgccgcaacggcgacccggcctgggccgagctagacggtggtgcaccg
gagggcagtgtgcgcggcagtgtgcgcggcactcacctgcacggcctgctcgaatcggac
gacttccggcgtgcgtggctgcgtgaggccgccgtccaggcgggacgtaccggtttccgg
gccgcgccagcgaccagcgtcgaggaggttcgcggcgcgcagctcgatctgctggccgac
ctgatcgagagccatctcgacatcggcgaactcgaacgactgatcgtcgccggtgccccg
cgcgacctgcccgtcctcaccgtcggatgctccgagaccgacgcgcggtag

DBGET integrated database retrieval system