KEGG   Nocardia nova: NONO_c64110Help
Entry
NONO_c64110       CDS       T03032                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
nno  Nocardia nova
Brite
KEGG Orthology (KO) [BR:nno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NONO_c64110
Enzymes [BR:nno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     NONO_c64110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP GspL_C
Motif
Other DBs
NCBI-ProteinID: AHH21181
UniProt: W5TVH0
Position
complement(6911536..6912432)
Genome map
AA seq 298 aa AA seqDB search
MLGGPRGPSGQDGRVRIDLHTHSTASDGTETPGELVRAAAAAGLDVLALTDHDTTAGWAE
AVAALPDGLRLVRGMEMSCVGMGEDGWPVPVHLLAYLFDPADPAFAAERERLRGERVARV
RAMAERMAADGLPIDPDAVVAAAGPAAGRPHLARALVDAGVVPTVGAAFTDLLAPRGRYY
AEKADTPLRQAVEMVAAAGGVTVIAHARARSRGRLLALDDIRELAGHGLAGLEIDHPDHR
DDDRIVLRELARELDLITTGSSDYHGADKSVRLGEYTTDPAQFEQLLERASGVAVIAR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcggcccgcgggggccgtccgggcaagatggacgcgtgcgcatcgacctccac
acccattcgaccgcgtcggacggtaccgagacccccggcgagctggtacgcgccgccgct
gccgccggactggacgtgctggcgctgaccgatcacgacaccaccgcgggctgggccgag
gcggtggccgcgttaccggacggcctgcgcctggtacgcgggatggagatgtcgtgtgtg
ggtatgggcgaggacggctggccggtgcccgttcatctgctggcctacctgttcgatccc
gccgatccggccttcgccgccgagcgtgagcggttacgcggggaacgggtggcccgggtg
cgcgccatggccgagcggatggccgccgacgggctgccgatcgatccggacgcggtggtc
gccgcggcgggtccggcggccggtcgcccgcatctggcgcgggccctggtcgatgcgggg
gtggtgccgacggtcggcgcggccttcaccgatctgctggcgccgcgcggccgctactac
gcggagaaggccgacactccgctgcggcaggcggtcgaaatggtcgccgccgcgggcggg
gtgacggtgatcgcccatgcccgggcccgctcccggggccgattgctcgccctcgacgat
attcgcgagctggccgggcacggcctggccgggctggagatcgaccatcccgatcatcgc
gacgacgatcggatcgtgctgcgggagctggcgcgtgaactggatctgatcaccaccggt
tcctccgactaccacggagccgacaaatccgtgcgcctgggcgaatacaccacggacccg
gcgcaattcgagcagctgctggagcgggcgagcggagtcgcggtgatcgcgcgatga

DBGET integrated database retrieval system