KEGG   Nocardia nova: NONO_c69830Help
Entry
NONO_c69830       CDS       T03032                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nno  Nocardia nova
Brite
KEGG Orthology (KO) [BR:nno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NONO_c69830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHH21744
UniProt: W5TRF3
Position
7614183..7615667
Genome map
AA seq 494 aa AA seqDB search
MTAELFVLLIVVVTALVFDFTNGFHDTANAMATSIATGALRPRTAVLLSGGLNLIGAFLS
VEVAATVADGIVRLDEVGGEDLLTIVFAGLVGGILWNLLTWLFGLPSSSSHALFGGLIGA
TVAALGWSGVIWSAGHKGVLTKIIVPALLAPVVAALVAAIGTWLVYRITRRSDQRVVNRG
FRWGQVGSASLVSLAHGTNDAQKTMGIIFLALIAYGSARPSDQLPLWVIVACAVAIAAGT
SLGGWRIIRTLGKGLVDITPPQGLAAESTSAAIILTSAHFGLPLSTTQTVTGAILGTGVG
RPGAEVRWSVLGRMVVAWVFTLPLAGVAGAICWAIAHGIGGLAGVLVVFGILIVLAGVIY
LRSRRTPVHASNVNEQWTNLPGAGPTTNGAPAAVPADPGSTAPRVPDAGSESPEGDDSAP
EVAHLAEAGPNRAQPGASAPEPDASDAGQAPAEEPSQSAGPDHADDRRDNGTTPRSAPQI
RDESQPSRHTARNL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgaactgttcgttctgctcatcgtcgtcgtcacggctctcgttttcgacttc
accaacggcttccacgacacagccaatgccatggcgacctcgatcgccaccggcgccttg
cgaccgcgcaccgcggtgctgttgtcgggcgggctgaatctcatcggcgccttcctcagc
gtggaggtcgccgccaccgtcgccgacggcatcgtccggctcgacgaggtcggcggcgag
gatctgctgacgatcgtcttcgccggactcgtgggcggcatcctgtggaatctgctcacc
tggctgttcggcctgccgtcgagttcgtcgcacgccctgttcggcggattgatcggcgcc
accgtcgcggccctgggctggagcggggtgatctggtccgcgggacacaagggggtgctg
accaagatcatcgtgcccgccctgctcgcgccggtggtggcggcgctggtcgccgcgatc
ggcacctggctggtctatcggatcacccgccgcagcgaccagcgggtggtgaatcgcgga
ttccgatgggggcaggtgggttcggcgtcactggtctcgctggcgcacggcaccaacgac
gcgcagaagaccatgggcattatcttcctcgcgctcatcgcctacggctccgcccggccg
tcggatcagctgccgctgtgggtgatcgtggcctgtgccgtcgccatcgccgcgggcacc
tcgctgggcggctggcggatcatccggacgctgggcaagggtctggtcgacatcaccccg
ccgcagggcctggcggccgaatccaccagtgccgcgatcattctcacctccgcgcatttc
ggcctgccgctgtcgaccacgcagacggtgaccggcgcgatcctcggcaccggcgtcgga
cggcccggtgcggaggtgcgttggtcggtgctgggccgcatggtcgtggcgtgggtgttc
accctgccgctggccggagtcgcgggcgcgatctgctgggccatcgcgcacggtatcggc
ggactggccggagtgctggtggtgttcggcatcctgatcgtgctggccggggtgatctat
ctgcgctcgcgccgcacacccgtgcacgcgtcgaatgtgaacgagcagtggaccaatcta
ccgggcgcgggtccgaccaccaacggcgctcccgctgccgtgcctgccgatcctggttcc
accgcaccccgggtaccggatgcgggctccgagtcgccggaaggcgatgacagcgcgccg
gaggtggcccacctggccgaggcgggaccgaatcgagcgcagcccggcgcgtccgctccg
gagccggacgcatccgatgcggggcaggctcctgccgaggaaccgtcgcagagtgccgga
ccggaccacgccgacgaccggcgcgacaacggcaccacgcctcgatcggccccccagatc
cgcgacgaatcccagccttcgcgccacaccgccaggaatctctga

DBGET integrated database retrieval system