KEGG   Nelumbo nucifera (sacred lotus): 104585628Help
Entry
104585628         CDS       T04131                                 

Definition
(RefSeq) non-specific phospholipase C4-like
Organism
nnu  Nelumbo nucifera (sacred lotus)
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 104585628
NCBI-ProteinID: XP_010240874
UniProt: A0A1U7YM47
Position
Un
AA seq 521 aa AA seqDB search
MASEVTNTKPFPIKTVVVLVQENRSFDHMLGWMKTLNPEIDGVSSGDEYYNLLSTTDPNS
KRVYFGNRSEYVDPDPGHSFQAIYEQVFGVPWGQSSLGVKMNGFAQNAENTQEGMSDTVM
NGFRPEAVPVYKELVSEFAVCDHWFASIPTSTQPNRMYVHSATSHGLISNDTKKLIEGLP
QKTIFESLEEAGFSFGIYYQDPPSTLFYRNLRKLKYINKFHQFDLDFKRHCKEGKLPNYV
VIEQRFFDSKLRPANDDHPSHDASEGQKFVKQVYETLRASPQWNEMIFIIIYDEHGGFYD
HVPTPTGVPSPDGIASSEPFYFKFDRLGVRVPAIFISPWIERGTVLHRPSGPYSTSEFEH
SSIPATVKKIFNLKEFLTKRDAWAGTFETVLNRESPRTDCPVTLAVEPRKLRAAEANEGA
KLSEFQEELVQLAATLNGDHRKDIYPHKLVENMTVKDASKYCEEAFKKFLEGCENVKKGA
DESEIVVLPTAAVQSPPEDSTPPSKSKSSTRKMFACFVCNN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaagttacaaacacaaagccgttccccattaaaaccgtggtggttttggtt
caagaaaaccgctccttcgatcatatgttgggatggatgaagaccctcaatcccgagatc
gatggtgtttcatccggagacgaatactacaaccttttatccacaaccgatccaaactcg
aaacgagtttacttcgggaaccgatcggagtatgtagaccctgatccgggccactcattt
caggccatttacgagcaggtgtttggcgttccatggggacagtcatctctgggggtgaag
atgaacgggtttgctcagaatgcagagaacacacaggaaggaatgtcagatactgtaatg
aatgggtttaggccggaagccgtgcctgtttataaggagttggtttcggaatttgcagta
tgcgaccactggttcgcatcaatccctacttcaacacagccaaaccggatgtatgtgcac
tctgcgacttcgcatggtttaatcagcaacgacacgaagaagttgattgaagggttgcca
cagaagaccatctttgagtcactggaggaggctgggttctctttcggaatatactatcag
gatcctccatccacacttttctacaggaatcttagaaaattaaaatacataaacaaattt
catcagttcgacctagacttcaagagacactgcaaggaggggaagctgccgaactatgtg
gtgattgaacaacgattctttgattcaaaattgcggccagcgaatgacgatcacccctct
cacgatgcctcagagggtcagaaatttgtgaaacaagtgtacgagacactgagagcgagc
ccacagtggaatgaaatgatattcataatcatatatgatgagcacggtgggttctatgat
catgtcccaactcctactggagttcccagtccagatggcattgcaagctctgagccattt
tactttaagtttgatcgtcttggcgttcgggtgcctgccatcttcatttctccatggatt
gaacggggaacagtgctgcataggccttcaggaccatattctacatcggaatttgaacat
tcctccattccggcaaccgtgaagaagattttcaatctgaaggagttccttacaaagcga
gatgcttgggctggcacttttgagaccgtcttgaacagggagagtccaagaacagactgc
ccagttactctggcagtagagccgaggaaactgcgagcagctgaagcaaatgaaggggca
aagctgagtgagtttcaagaggagttggtacagttggcagctacgctgaatggagaccat
agaaaggacatttatccacacaagttagtagagaacatgacggttaaagatgccagcaag
tactgcgaagaagccttcaagaaattcttagagggatgtgagaatgtcaagaagggagca
gatgaatctgagattgttgtattaccaactgcagcagtgcaatcacctcctgaggactca
actccaccttctaagtccaagtcctctactcggaaaatgtttgcttgttttgtttgcaac
aactga

DBGET integrated database retrieval system