KEGG   Nelumbo nucifera (sacred lotus): 104585729Help
Entry
104585729         CDS       T04131                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104585729
Enzymes [BR:nnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     104585729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Phyto_Pns9_10 HU-CCDC81_bac_2 PROCN
Motif
Other DBs
NCBI-GeneID: 104585729
NCBI-ProteinID: XP_010241001
UniProt: A0A1U7YTG3
Position
Un
AA seq 564 aa AA seqDB search
MSSQISSCPPTQHSSSEAEKTELIRHTTNFHPSIWGDRFITYTCDNMKLESYNQQVEELK
EEVRSILRNSANKPLEMLSLIDAVQRLGLGYHFEREINKMLEQIFDAHIVYFNDMDDNLN
AVALLFRLLRQHGYNIPCDVFKKFKDEDGKLRESLARDIQGMLSLYEAAYLGKRGEEVLD
EALAFTTAHLKSTVATDTTSPTLVKQVKHALEQPLHRGIPKIEARHYISFYEEDKSRNQV
LLKLAKLDFNRTQLLYLNELSQVSRWWKNIDFTSKTPYARDRLAECYFWSAGALPEPQYS
LGRKTLAKIVAINTILDDTYDAYGTFEELQLLTDAIRRWDANETDKLPEYMKVIYVTLLD
IYNEIEEEMRKEGRCFCVSYAKEAMKDLIEAYQIEATWLKEGHIPTFEEFSKLGLITSTY
IMMTNVIFACMGEMATKEVFDWLSKTPDAVKSSCIIGRFSDDIMTNEFEQERGHVCSAIE
CYMKQYGVSREEANNELRKIVTKAWKVLNEECITPTAAPMPLLIPVVNLARLIEVVYKHG
DAFTNVTTGLKTHIKLLLIDPITI
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccaaatttcatcatgcccccccacccagcattcttcttcggaagccgaaaaa
acagagctcattcgtcacaccaccaatttccacccaagcatttggggagatcgtttcatt
acttacacttgtgataacatgaaacttgagtcttacaatcaacaagttgaagagctaaaa
gaagaagtgaggagcattttaaggaattctgccaataaaccattggaaatgttgagtttg
attgacgcagtccaacgtcttggcttggggtatcattttgagagagagataaacaagatg
ctagaacagatattcgatgcccacattgtctactttaatgatatggatgataatctcaat
gctgttgcccttctgtttcgattactcaggcaacatggttataacataccatgtgatgtg
ttcaagaaattcaaagatgaagatggaaagcttagagagagcttggctagagatatacaa
ggtatgctgagtttgtatgaagctgcataccttgggaaacgtggagaagaagttctagat
gaagcccttgcttttaccactgctcatctcaagtcgactgtggctacggatacaacttcc
cctactcttgtaaaacaagtgaagcatgccctagagcagcctctccacaggggaatacct
aagatagaggcacgacattacatctctttctacgaagaagacaaatcacgaaatcaagtt
ctgctcaagcttgctaagttagatttcaacagaacacagttgttatatctcaacgagcta
agccaagtatcaaggtggtggaagaatatagattttacatcaaagacaccttatgcaaga
gacagactggcagagtgctatttttggtcagctggagctcttcctgaaccccaatactct
cttggacgaaagactctcgccaaaatagttgccatcaatacaattttagacgatacttac
gatgcatatggtacctttgaagaactccagctccttacggatgcaatccgaaggtgggat
gccaatgaaactgataagctaccggaatacatgaaagtgatatatgttacactcttagat
atttacaatgaaattgaagaagagatgagaaaggaaggaagatgtttttgtgtctcttat
gcaaaagaagcgatgaaggatttgattgaagcctaccaaattgaagccacatggttgaaa
gaagggcatattcctacatttgaagagtttagcaagcttggcctaattaccagtacatac
attatgatgacaaatgtaatcttcgcatgcatgggagaaatggcaacaaaagaggtgttt
gattggctatcaaagacacctgatgctgttaagagttcatgtatcatcggtcgattctcg
gatgacatcatgactaacgagtttgagcaagagagagggcatgtctgctctgccattgaa
tgttatatgaagcagtatggtgtgtcaagggaagaggcaaacaatgagttacgtaagatt
gtcacaaaggcatggaaggttttgaacgaggaatgtatcacaccgactgccgcaccaatg
cctctgctaatcccagttgtcaaccttgcacgccttatagaagtcgtctacaagcatgga
gatgccttcaccaacgtcactacagggttgaaaactcacatcaaacttttgctcattgat
cccatcacaatctga

DBGET integrated database retrieval system