KEGG   Nelumbo nucifera (sacred lotus): 104586082Help
Entry
104586082         CDS       T04131                                 

Definition
(RefSeq) probable succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00020  Citrate cycle (TCA cycle)
nnu00640  Propanoate metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104586082
   00640 Propanoate metabolism
    104586082
Enzymes [BR:nnu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104586082
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104586082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 104586082
NCBI-ProteinID: XP_010241497
UniProt: A0A1U7YR97
Position
Un
AA seq 346 aa AA seqDB search
MAHLSARKTSKILSSLAPRFCLSKAILSSALSSLSSSQCRHFAAAPVPPPAVFVDKNTRV
ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI
YVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
CMNKFLVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKTLREAGVTVVESPAKIGAAMLDVFKQRGLLS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacctatcagctagaaaaaccagcaagatcctcagctccttggctccaaggttc
tgcctgagcaaggccattctctcgtccgctctttcttcactttcttcgtcccagtgtcgc
catttcgccgccgccccagtgccacctcctgccgtgtttgttgacaagaacactcgggtc
atttgccagggcattaccggaaagaacggtaccttccacactgaacaagctatcgagtat
ggcaccaaaatggttggtggggtgacaccaaaaaagggtggaactgagcacttgggactt
cctgtcttcaatacagttgctgaagcgaaagcggaaacaaaggcaaatgcatcagtcatt
tatgttcctcctccatttgctgcagcagctatcatggaggccttggaggctgaattggat
ctagttgtatgcatcacagaaggaatccctcagcatgacatggtgcgagtgaaggctgct
ttaaacaagcaatccaagaccaggttgattgggccaaactgcccaggcattatcaagcca
ggagagtgtaaaattggaatcatgcctgggtacattcacaaaccaggacgtgtagggatt
gtttctcgatctggtaccttgacgtatgaagcggtcttccaaacaactgctgttggccta
ggtcaatcaacctgtgtaggcattggtggtgacccttttaatgggaccaactttgttgat
tgtatgaataaattccttgtggatcctcagactgaaggtatcattctaataggagagatt
ggagggactgcagaagaggatgctgctgctctgattaaggaaagtgggactgagaaacct
attgttgcatttattgctggacttactgcaccacctggccgtcgtatgggtcatgctgga
gctattgtgtcaggtggaaaaggtacagcccaagataaaatcaagaccctcagagaagct
ggggttacagttgttgaatctccggcaaagataggtgctgccatgcttgacgtctttaag
cagcggggtcttttaagctag

DBGET integrated database retrieval system