KEGG   Nelumbo nucifera (sacred lotus): 104586952Help
Entry
104586952         CDS       T04131                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu03040  Spliceosome
nnu04141  Protein processing in endoplasmic reticulum
nnu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104586952
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104586952
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104586952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nnu01009]
    104586952
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nnu03041]
    104586952
   03009 Ribosome biogenesis [BR:nnu03009]
    104586952
   03110 Chaperones and folding catalysts [BR:nnu03110]
    104586952
   04131 Membrane trafficking [BR:nnu04131]
    104586952
   03051 Proteasome [BR:nnu03051]
    104586952
   03029 Mitochondrial biogenesis [BR:nnu03029]
    104586952
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nnu04147]
    104586952
Protein phosphatases and associated proteins [BR:nnu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104586952
Spliceosome [BR:nnu03041]
 Complex B
  Other components
   Prp19 complex
    104586952
 Complex C
   Prp19-CDC5 complex
    104586952
Ribosome biogenesis [BR:nnu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104586952
Chaperones and folding catalysts [BR:nnu03110]
 Heat shock proteins
  HSP70 / DNAK
   104586952
Membrane trafficking [BR:nnu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104586952
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104586952
Proteasome [BR:nnu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104586952
Mitochondrial biogenesis [BR:nnu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104586952
Exosome [BR:nnu04147]
 Exosomal proteins
  Proteins found in most exosomes
   104586952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA EutA Hydantoinase_A ARS2
Motif
Other DBs
NCBI-GeneID: 104586952
NCBI-ProteinID: XP_010242658
UniProt: A0A1U7Z6V5
Position
Un
AA seq 400 aa AA seqDB search
MASAAQIHILGGSAFPSPSTKSGVGNGRPSRTVFFGQGLNGSGASFGIPQSAFLKLKRNS
RREYAVGPVRVVSEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDR
LVGQIAKRQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYRVVRDENGNVKLECPAIGK
QFAAEEISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRI
INEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFD
KRIVDWLAENFKRDEGIXLLKDKQALQRLTETAEKAKMEAMKDAMAALNQEVMQLGQSLY
NQPGSPGAGPAPGGEAGPSSGSAGKTPDGDVIDADFTDSS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcggctcaaattcacattctcggcggttctgcgtttccatccccttcgaca
aagtccggtgttgggaatggaaggccttcaagaactgttttcttcggacagggattaaat
ggcagcggcgcttcgtttgggattccacagtcggctttcctgaaacttaagagaaatagc
aggagagaatatgcagttggtcctgttcgggttgtaagcgagaaggttgtcggtattgac
cttgggacgacgaactcagcagtggcggcgatggaaggtgggaagccgacaattgttact
aatgctgagggtcaaagaacgacgccttcggtcgttgcgtacacgaagaacggagaccga
cttgtagggcagattgcgaagaggcaggcggttgtgaatccggagaacactttcttctct
gtgaagaggtttattggaaggaaaatgtctgaggtagatgaggaatcgaagcaggtttcc
tatagagtggtgagagatgagaacggtaatgtcaagcttgagtgcccagccatcggcaaa
cagtttgctgccgaggagatttcggcgcaggtattaaggaaacttgtagatgatgcatcc
aagtttttgaatgataaggttaccaaggctgtagttacagtacctgcttacttcaatgat
tcgcaaaggacagcaacaaaagatgctggtcggattgctggtttagaagttctccgtatc
atcaatgaacccactgctgcttcactggcatatgggtttgaaaagaagaacaatgaaacc
attctagtatttgaccttggaggtggaacatttgatgtatcagttcttgaagttggagat
ggagtgtttgaggtgttgtctacatcaggagatacacatctgggtggagatgactttgac
aagagaattgttgattggcttgctgagaacttcaagagagatgaaggcatagrtcttctg
aaggacaaacaggctcttcagcgtcttactgagacagctgagaaagccaagatggaagcg
atgaaagatgctatggctgcgctcaaccaagaagtaatgcagcttgggcagtccctatac
aaccaacctgggtcacctggtgctgggcctgcacctggtggagaggccgggccttcttca
ggatcagctggcaagacacctgatggtgatgtgattgatgcggatttcactgatagcagt
tag

DBGET integrated database retrieval system