KEGG   Nelumbo nucifera (sacred lotus): 104587444Help
Entry
104587444         CDS       T04131                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00562  Inositol phosphate metabolism
nnu01100  Metabolic pathways
nnu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104587444
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104587444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nnu01009]
    104587444
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104587444
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104587444
Protein phosphatases and associated proteins [BR:nnu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104587444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM bPH_3 Y_phosphatase EspA
Motif
Other DBs
NCBI-GeneID: 104587444
NCBI-ProteinID: XP_010243361
UniProt: A0A1U7YSW4
Position
Un
AA seq 830 aa AA seqDB search
MEGAGSWDVLEWTKVEPVSRSVPPGVKGFLLEAEEIIAEGYGVVLVNTDEAGTLFVTNFR
LIFLSEGTRKIIALGTIPLATIEKFSKLVLKLPSAPHQSDKTPSRRLLQVVGKDMRIIVF
GFRPRTKQRHAIFDALWRCTRPARLGDLYTFIHGPSKSTNTNPKARLLDEYCRLLGKSSY
HVSSSIVEDGSSSLSNEWWRISWVNSNYTMCPTYPFSFIVPKSVSDEEVLQASTFRARCR
LPVISWCHPGTGAVIARSSQPLVGLMMNMRSNADEKLVAALCTQTASMRGPRRKLYIADA
RPRKNALANGAMGGGSESPSNYFQSEIVFFGIDNIHAMRDSLARLRDYLDTHGATSSDGV
SSFLRNGGWTWGGGHLSSMSASVSTLGDSGWLIHIQSVLAGSAWIAARVALESSSVLVHC
SDGWDRTTQLVSLASLLLDSYYRTFKGFQALVEKDWLAFGHPFSDRMGMPTISGNSNMPP
ELFRQSSGGNIPTSPMRSSSGSSPAGSSSPAQTSSNYSPIFLQWVDCVSQLLRMYPFAFE
FSSAFLVDFLDCILSCRFGNFLCNSEKERQQAGVSNACGCLWIYLDELCASEGKSHAHYN
PFYDPLKHEGPLLPPAAALAPTLWPQFHLRWACPSGAQAGELEAQCRILAKKFSEMQKAK
EVAERKAKDIITSMESLTAELQKEKQLSSTTMDLTKRACRENAAIKRAIQSLGCKVNFSS
NGDCSLEIGSTLEEIQQNVIYPPKGDSYGNRQVKEKSDLSVSVSLLSDDTVSDNPISWVC
ETLCPLRTREGGCKWPDAGCAQFGSQFVGLKANFDAFDSLSIYDCYFGSE
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgccgggagctgggacgtactcgaatggactaaagtcgagcctgtttcgagg
tccgtacctcctggtgtgaaaggttttttattggaggcggaggaaattatagcggagggc
tacggtgttgttctcgtgaatactgatgaggcaggcaccttgtttgttaccaattttcgc
cttatttttttgagtgagggcactaggaaaataattgcacttggcacaataccattggca
acaattgagaagttcagcaagcttgtcctgaagcttccctctgcccctcatcaatctgat
aaaactccatcacgtcgacttctccaggttgttggtaaagacatgagaataattgtcttt
ggatttcgcccacgaacaaaacagaggcatgctatttttgatgcattatggagatgtaca
aggcccgcacgactaggggatctttataccttcatacacggaccttctaagtcaaccaat
accaatccaaaggcacggttattggatgagtattgtcggctccttggaaaaagctcctac
catgtatcaagtagtatagtggaagatgggtcgtcgtctttgtccaatgagtggtggaga
ataagttgggtgaattccaattatacaatgtgtccaacatatccattctccttcattgtc
cctaaaagtgtaagtgatgaagaagtgctacaggcttctacttttcgtgcaaggtgtcgg
ttacctgtgatttcgtggtgtcatccaggaactggtgctgttattgcacgttcatcccaa
cctttagttggtctcatgatgaatatgaggagcaatgctgatgaaaagcttgttgctgca
ctttgcactcaaactgcaagtatgaggggaccacgaaggaaactctatattgctgatgca
agaccaagaaaaaatgctttagcgaatggggcaatgggaggtggttctgagtcaccttct
aattatttccaatctgagatagttttctttggaatagacaatatccatgccatgagggat
agtcttgctcgactcagggactacttagatactcacggtgccacttcttcagatggagtg
tcgtcatttttgagaaatggtggatggacctggggtgggggacatcttagcagtatgtca
gcttcagtttccaccctgggagatagtggatggctaatacatattcaaagtgttctagct
ggttctgcttggattgcagcacgtgttgctttggagtcatcctcagttcttgtgcattgc
agtgatgggtgggatagaacaacacagttggtctcacttgctagtttgctgcttgattct
tattatcggacgtttaagggatttcaggcactagttgaaaaggattggcttgcatttggc
catccattttcagatcgcatgggaatgccaacaatatctggaaacagtaacatgcctcca
gagctctttcgacaatcttcaggtgggaatattccaacatcacccatgcgctcctcatca
ggatcatcaccagctggtagttcatcgcctgcacaaacatcaagcaactattctcccata
tttttgcagtgggttgattgtgtttcacagttacttcggatgtatccttttgcttttgag
ttctcctcggcattcttggttgatttcttggactgcatactttcatgtcgttttggaaac
ttcttatgcaacagtgaaaaggaaaggcagcaggctggtgtttccaatgcttgtggatgc
ttatggatctacctggatgagttgtgtgcatctgagggaaagtctcatgcacactataac
cccttctatgatccattgaaacatgaggggccattattacctccagcagcagcactggct
ccaaccctatggcctcaattccatcttcggtgggcctgtccctcaggggcacaagctgga
gagctcgaagctcaatgtaggattttggctaaaaaattttctgaaatgcaaaaggcgaaa
gaagtggcagaaaggaaggctaaagacatcataacaagcatggaatccttaactgctgaa
ctacaaaaagaaaagcagcttagcagcactacaatggatttgactaagagggcctgcagg
gagaatgcagccataaaacgggcaatacagtcactaggatgcaaggttaacttctcaagt
aatggtgactgttccttggaaataggaagcactctagaagaaatacagcagaacgttata
tatcctccaaagggagactcgtatggaaatagacaagtgaaagagaaatcagatctttct
gtatctgtctctcttctgtcagatgatactgtttctgacaacccaatcagttgggtatgt
gaaacactatgtccactgcgcactagggaaggtggttgcaagtggccagatgctggttgt
gcacaatttgggagccagtttgttgggctgaaagcaaactttgatgcatttgatagtctt
tctatttatgattgttattttggatcagaatag

DBGET integrated database retrieval system