KEGG   Nelumbo nucifera (sacred lotus): 104587607Help
Entry
104587607         CDS       T04131                                 

Definition
(RefSeq) probable nucleolar protein 5-1
  KO
K14565  nucleolar protein 58
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    104587607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nnu03009]
    104587607
Ribosome biogenesis [BR:nnu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    104587607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 104587607
NCBI-ProteinID: XP_010243588
UniProt: A0A1U7YZF6
Position
Un
AA seq 577 aa AA seqDB search
MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKMVKLKAFSKFENTSEALSAA
TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNTVMELMRGVRSQ
LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNIHYAKAVKLMGSRSNAAKLDFSEILPEEVETELKEAAVISM
GTEVSDLDLMNIKDLCDQVLSLSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIFHASLIGQAAPKLKGKISRSL
AAKTALAIRYDALGDGQDNTMGLENRAKLEARLRNLEGRELGRSAGSTKGKPKIEFYDKD
RKKGAGALITPAKTYNTAADSVLGRTAEPVAEKLEKEEAVEEAPVKGDEEKEKKEKKEKK
EKKEKKKKKKADVEDADLKGNNEISVEPEGEETETKKKKKKKKAEAGTAEAQNEDEAVEP
QVEEKKKKKRKHAENDEEETEMQSKKKEKKKKKKSED
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcttgttcgaaactccggcgggctttgccctatttaaagtattagatgaaggg
aaactctctaaagtcgaggacttgtggaaggagttctcgacatcagaatccgctagaaag
atggtgaagctgaaagctttctccaaatttgagaacacatctgaagctttatcagcagca
acattgctgattgatagcaagcctagcaaggctcttcgcaagttcttgcgtgcacattgt
gatggagaaactttagcagtggcagactcaaaatttgggaatgcaataaaagaaaaattg
aaaatagaatgtgtacacaataatactgtaatggagctgatgaggggtgtgagaagtcag
ttgactgaattaatatctgggttagcagttcaagatttggctccaatgagcttgggttta
tcacacagtttatctagatacaagctaaaatttagccccgataaggtggatactatgatt
attcaggccattggtttgctggatgatcttgacaaggagctaaatacgtatgcaatgcga
gtccgggaatggtatggctggcatttcccagagcttgcaaagattgtacaagacaacatc
cattatgccaaagcagtgaaattgatgggcagtcgttcaaatgctgcaaagcttgatttc
tctgagatactgccagaagaggttgagacagaacttaaagaggcagcagtgatttcaatg
ggaacagaagttagtgacttggatttgatgaatatcaaagacctatgtgatcaggtgttg
tctctctcagagtatagagctcaactgtatgattacttaaaaagcagaatgaatacaatt
gccccaaatttgactgctcttgttggagaacttgttggtgctcgccttattgcacatggt
ggcagcttgttgaatcttgcaaagcagcctggaagcactgtccaaattcttggtgcagaa
aaggccctctttagagctttgaagacaaagcatgctactccaaaatatgggcttatcttc
catgcatctttaattggtcaggcagccccaaagcttaaaggaaaaatttctagatcactt
gctgctaagactgcattagctattcgatatgatgctcttggagatggccaagataacaca
atggggctggagaaccgagccaagcttgaagctcggttgaggaatctcgagggcagagaa
ctgggccgctcggccgggtcaactaaaggcaaacctaagatagaattctatgacaaagat
cggaagaaaggtgcaggggcattgataactcctgctaagacttataacaccgcagccgat
tcggtacttggacgaactgctgaaccggtggctgagaagctggagaaagaggaagcagtt
gaggaggctcctgttaaaggtgatgaagagaaggagaagaaggagaagaaggagaagaag
gagaagaaggagaagaagaagaaaaagaaggctgatgttgaggatgctgatctaaaaggt
aacaatgagattagtgtggaacctgaaggggaagagacagagactaaaaagaagaagaag
aaaaagaaggctgaagctggaactgctgaagctcaaaatgaggacgaagctgttgaaccg
caggtggaagaaaagaagaaaaagaagagaaagcatgcagaaaatgatgaggaagaaact
gagatgcaaagtaagaagaaagagaaaaagaagaagaagaagagcgaagactga

DBGET integrated database retrieval system