KEGG   Nelumbo nucifera (sacred lotus): 104588161Help
Entry
104588161         CDS       T04131                                 

Definition
(RefSeq) arginine--tRNA ligase, chloroplastic/mitochondrial-like
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104588161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nnu01007]
    104588161
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nnu03016]
    104588161
   03029 Mitochondrial biogenesis [BR:nnu03029]
    104588161
Enzymes [BR:nnu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     104588161
Amino acid related enzymes [BR:nnu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   104588161
Transfer RNA biogenesis [BR:nnu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104588161
 Prokaryotic Type
   Other AARSs
    104588161
Mitochondrial biogenesis [BR:nnu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    104588161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-GeneID: 104588161
NCBI-ProteinID: XP_010244286
UniProt: A0A1U7Z129
Position
Un
AA seq 645 aa AA seqDB search
MTRVLHLLPATSSSPPLVSFNRLSHLHSHPVLLKTDFSRLRPRRLVSTTITASVSVSTMD
QEIVGHVKQQLSKLFEASLRTTVPDELDVEPLVVPCTGKFGDYQCNNAMSLYSRIKGKTT
QFRGPPAIGQAIMKNLPPTKMIESCSVAGPGFVNVVLSTKWIAKSIQKMLIEGIETWAPR
LRVKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSNVEVLRRNHVGDWGTQFGML
IEFLFEEFPNWEGIGEQAIGDLQAFYKASKTRFDADPAFKERAQQAVVRLQGGEAKYHRA
WAKICEISRREFDQVYQRLGVHLEEKGESFYNPYIPGVIEGLSKQGMVEESEGARVIFIE
GKNIPLIVVKSDGGYNYASTDLAALWYRLNEEKAEWIIYVTDVGQQQHFEMFFSAAKHAG
WLPSDGKAYPQATHVGFGLVLGDDGKRFRTRSTEVVRLVDLLDEAKNRSKAALIERGKGA
EWSDKELEQTAEAVGYGAVKYADLKNNRLTNYTFNFDQMLNDKGNTAVYLLYAHARICSI
IRKSGKDIEELKKTATVVLDHPDERVLGLHLLQFAETVEEACNNLLPNVLCEYLYNLSEN
FTKFYSNCQVVGSAEETSRLLLCEATAVVMRKCFYLLGIVPVYKI
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacgagggtattacatttactacctgcgacttcttcatctcctccgttggtctccttt
aatcgcctctctcacttgcattcacacccggttcttcttaaaaccgatttttcaagatta
agacctcgaaggcttgtttccacaacaattacggcatcagtgtcagtgtcaaccatggac
caagaaattgtgggtcatgtcaagcaacagctatcgaagctatttgaagcatcgcttaga
acaacggtccccgatgaattggatgtagaacctttggttgttccttgcactggaaagttt
ggtgattatcaatgtaataatgctatgagcttatattcaaggattaaaggcaagacgact
caattcaggggccctcctgctattggacaggccattatgaagaaccttcctccaactaaa
atgatagagtcttgttctgttgcaggacctggatttgtcaatgttgttttgtcaaccaaa
tggatagctaagagtatacaaaagatgcttatagagggtattgaaacatgggcaccaagg
ctccgggtcaaaagggctgtggttgacttctcttcacccaatattgcaaaagaaatgcat
gtcggccacttgagatcaaccattattggagatactctagctcgcatgctggaatattcg
aatgttgaagttctgcggcggaaccatgttggcgattggggtacacagtttggtatgttg
atcgagttcctttttgaggaattcccaaactgggagggtataggggagcaagctattgga
gatctacaggcattttacaaggcatccaagacgagatttgatgctgatcctgcctttaag
gagagagcacagcaagcggtggttcgcttacagggtggggaagcaaagtatcacagagca
tgggcaaagatctgtgaaataagtcgcagggaatttgatcaggtgtatcaacgccttggt
gtgcatctggaggaaaagggagagagcttttataacccatatattcctggggttattgag
ggattaagtaagcaagggatggttgaagaaagtgagggtgcccgtgtgatcttcattgaa
gggaaaaatatacctcttattgttgtgaagagcgatggtggatacaactatgcttcaact
gatctagcagcactttggtatcgtcttaatgaagaaaaagctgagtggataatttatgtc
actgatgttgggcaacaacaacacttcgaaatgtttttcagtgctgcaaaacatgctggt
tggcttccatctgatggcaaggcctatccccaagcaactcatgtggggtttggtcttgtt
cttggagatgatggtaagcgctttcggactcgaagcactgaagtggttcgattagttgat
ttacttgatgaagctaagaaccgcagtaaagcagcacttattgaacgaggtaaaggtgca
gaatggagcgataaggagctcgaacaaactgctgaagctgttggttacggggctgttaaa
tatgctgatctgaagaacaatcgactaacaaattatacatttaattttgatcaaatgctt
aatgataagggaaatacagctgtttacctcctctatgcacatgctcgtatttgttcaatc
atcagaaaatctggtaaagacattgaagagttgaagaagacggcaacagttgtgctggat
catccagatgagcgtgtcttggggcttcatctactccagtttgctgagactgttgaggag
gcttgcaacaatctcttgccgaatgtgttgtgcgaatatctctacaacttgtcggagaac
ttcactaaattttattccaattgtcaggttgttggatcggcagaggagacgagtagattg
ctgttatgtgaagcaacagccgtagtcatgaggaaatgcttttatctacttggaattgta
cctgtctacaaaatatga

DBGET integrated database retrieval system