KEGG   Nelumbo nucifera (sacred lotus): 104588187Help
Entry
104588187         CDS       T04131                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK7
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nnu01001]
    104588187
Enzymes [BR:nnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104588187
Protein kinases [BR:nnu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104588187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Pkinase_fungal TMEM154 DAP10 DLH SARAF Cadherin_C_2 Herpes_gE EphA2_TM ABC1 Plasmodium_Vir
Motif
Other DBs
NCBI-GeneID: 104588187
NCBI-ProteinID: XP_019051650
UniProt: A0A1U8Q0T8
Position
Un
AA seq 581 aa AA seqDB search
MASSPETATSPETSSSSSSPTTPSPSSSPPAPPKSSAQSPSSSTQKPQPPSTTESPPSPS
SNKNRSPPSPSSSSDAPPPPPPPRQQSSSTPSSSSSSSGALSPPSTPKQKTPSSSGSRSP
THSESSSHNSSSAPLLVGLAVTAMALLLIMIVVCVCLSNKRKRRPQNQLPYYTDPPFGHK
GNAYYNGTPLQNWQYNSPLRGDHIVKIPPPPGFMGSPAAAGWHAAPPPPPPATSSGDLSS
TSSGPHNPPLPPPSPCVALGFINQSTFSYEELAAATGGFSEKNLLGQGGFGHVHKGVLPN
GKEIAVKSLKSGSGQGEREFQAEVEIISRVHHRHLVSLVGYCMGGGHRILVYQFVPNGTL
EYHLHGKDRPTMDWPTRLRIALGSAKGLAYLHEDCHPRIIHRDIKTANILLDNNFEAMVA
DFGLAKLSSDKYTHISTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVD
TANSYMDDSLVDWARPILTHVQSDGNYGELVDPRLENNYNPSEMARMVACATASIRHSAR
RRPKMSQIVRVLEGDVSLDDLNEGIKPSQSAIFGSNGGASD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctcctgagactgctacgtcgccagaaacatcttcttcatcatcatcacca
acaactccgtcaccatcgtcatcaccaccagcacctccgaaatcatcagcacaatcgcca
tcatcatcaacccaaaaacctcaacccccctctacaactgaatcaccaccttctccttcc
tcaaacaagaatagaagtccaccttcaccatcatcatccagcgacgctcctccaccgcca
ccgccaccacgacagcagtcctcatcaacaccatcttcttcttcttcttcttccggggca
ttgtcacctccaagtacgccgaaacaaaagaccccatcgtcgtcgggttcacgttcacca
acacattctgaaagctcgtctcacaattcgtcatccgcaccccttctagtaggactcgca
gtgacagcgatggcgttattactcattatgattgtcgtctgtgtatgcttatccaataag
agaaaaagaaggccgcagaatcagcttccatactacactgatcctccttttggacacaaa
ggcaacgcatactacaatggcacgccgcttcaaaattggcagtataacagccccctacga
ggggatcacattgtgaagattcccccacctccgggctttatggggtcaccggcggctgca
gggtggcatgcagcaccgcctccacctccaccagcgacgagcagtggtgacttgagctcc
acttcctcaggtccacacaatcctccgttgccgcctccttctccatgcgtcgctcttgga
ttcatcaaccagagtaccttctcctatgaagaactagcagcggcaaccggtggattctct
gagaaaaacttgttgggtcaaggtgggtttggtcatgtacataagggagtgttgccaaat
ggaaaggagatagcagtaaagagcctaaagtcgggtagcgggcaaggagagagagagttc
caagcagaggtggaaatcatcagccgtgttcatcaccgtcaccttgtttcacttgttggc
tactgtatgggtggggggcatcggattttggtctaccaatttgttcccaacggaacacta
gaataccaccttcatggaaaggatcgtcccacaatggattggcctacaaggctccggatt
gcattgggatcagccaaagggcttgcataccttcatgaagattgccaccctcgcatcatt
catcgtgacatcaaaactgcaaatattctgcttgacaataattttgaggccatggtggcc
gattttgggttggcgaaactctcttctgacaaatacactcacatctcaacacgagtcatg
ggaacatttgggtatttggcacctgaatatgcatcaagtggcaagctaactgagaaatct
gatgttttctcatttggtgttatgctattagaactgatcactggacgacgccctgtggat
accgccaattcatacatggatgatagcttagtagattgggcaagacccattttgacacat
gtacaatcggatggcaactatggagagttggtggatcctcgccttgaaaacaattataac
cctagtgagatggcacgcatggtagcttgtgctactgcaagcattcgtcattctgcaagg
aggcgcccaaaaatgagtcagattgtgcgtgttttagaaggtgacgtctcactggatgat
ttgaatgaggggataaaacctagccaaagcgctatatttggctcaaatggcggggcttcg
gactga

DBGET integrated database retrieval system