KEGG   Nelumbo nucifera (sacred lotus): 104588239Help
Entry
104588239         CDS       T04131                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial-like
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00970  Aminoacyl-tRNA biosynthesis
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104588239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nnu03029]
    104588239
Enzymes [BR:nnu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     104588239
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     104588239
Mitochondrial biogenesis [BR:nnu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    104588239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 104588239
NCBI-ProteinID: XP_010244391
UniProt: A0A1U7YXX5
Position
Un
AA seq 130 aa AA seqDB search
MSTRASFVMGVSSLLQSRCLWSSQWRARNYSVPSALLPPDLPLLAETARISLIPKEAEEF
APKIRQVIDWFGQLQAVDLQSIEPALRADTEGDNLRNDVPETFENREAMLAAVPSFEEPY
IKVPKVLNKE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagagcatcatttgtaatgggagtatcatctcttctacaaagcagatgcctt
tggtcatcccagtggagagctcggaactactctgttccctccgctcttcttccccctgac
ttgcctcttttagcagagaccgctcgcatctctctcattcccaaagaggcggaggaattc
gcccccaagattcgacaagttatagattggtttggacaactccaagctgttgatcttcaa
agtattgagcctgcacttagagcagatactgaaggtgacaatctgcggaatgatgtgcct
gaaacatttgagaatagggaggccatgttagctgcagttccaagctttgaggagccatat
atcaaagttcccaaggtcttgaacaaagaatag

DBGET integrated database retrieval system