KEGG   Nelumbo nucifera (sacred lotus): 104588306Help
Entry
104588306         CDS       T04131                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00020  Citrate cycle (TCA cycle)
nnu00310  Lysine degradation
nnu00380  Tryptophan metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104588306
  09105 Amino acid metabolism
   00310 Lysine degradation
    104588306
   00380 Tryptophan metabolism
    104588306
Enzymes [BR:nnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     104588306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 104588306
NCBI-ProteinID: XP_010244480
UniProt: A0A1U7ZB64
Position
Un
AA seq 531 aa AA seqDB search
MLGIIRRKLACGGSSASILGQSFQRIPVVSGPRSCTTARKKALLLRRGSKEVENLIHHTL
PGGSVTSKPVREFVAFGKTRSPICVWSRLFSSDNEGSPCQSKLVASRERRNPRRKRKALS
EVSPYLDDDWSSSDDSSASDTEDSSNIGSVELNSAGDMVDAVVPFMGESITDGTLAKFLK
KPGDSVQVDEPIAQVETDKVTIDVASPEAGVIQKFVAKEGDTVEPGTKIAVISKSGEGAA
LATPSEKKSDKEASQPPPPEKETVAKEETKADILAIKQRPKTPSPPPKASATEPQLPPKE
RERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFLEKHGLKLGF
MSGFVKAAVSGLQNQPIINAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNADKMNFAE
IEKEINTLARKANDGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIVTR
PMVVGGNIVPRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggggattattaggcgaaaactcgcttgtggtggatcgtctgcttcgattttaggg
cagtcatttcagaggattcctgtcgtgtctggacctaggagttgtacaaccgcacgaaag
aaggcattattacttagaagaggatccaaggaagttgagaacctaattcaccacacactg
cctggtggttcagttacttcaaaacctgtgagggaatttgttgcatttggaaaaacaagg
agtcctatttgtgtgtggagtagattattttcttcagacaatgaagggtctccttgccaa
agtaaattggttgcctcccgagagcggcgcaatcctcgtagaaaaaggaaggctctttct
gaagtttcaccctatttggatgacgattggtcgagcagtgatgacagtagtgcctcagac
actgaggactcctccaacatagggagtgtagagttgaattctgcaggtgacatggttgat
gcggttgtcccattcatgggtgaatctataactgatggcactcttgcaaaattcttgaag
aaaccaggtgatagtgtacaggttgatgaaccaattgctcaagttgaaacggataaggtg
accattgatgttgcaagtcctgaagctggagttatccagaagtttgtagcgaaggaaggt
gatactgtggaaccaggaaccaagattgcagttatttcaaagtctggtgaaggtgctgca
cttgctactccatcagagaagaagtcggataaagaggcttctcagccacctcctccagaa
aaggagactgtggccaaagaagagactaaagccgacattcttgccatcaagcagaggcct
aaaacaccttcaccaccaccaaaagcctcagctacagaacctcagcttcctcccaaggaa
agggaaagacgggttcctatgacaaggctcagaaaacgggtagcaacacgtttgaaagac
tctcagaacacatttgcaatgttgacaacattcaatgaagttgatatgactaatttgatg
aagctccgttctgattataaagatgcctttctggagaagcatggtctgaagctaggattt
atgtcaggatttgtcaaagctgctgtcagtgggcttcagaatcagccaataatcaatgca
gtcattgatggggatgatatcatatatagggattatattgatattagtattgctgttggt
actcctaagggccttgttgttccagtcatccgtaatgcagataaaatgaactttgctgag
atagagaaagagattaatactcttgcaaggaaggctaatgatggcaccatatcaattgat
gagatggccgggggttcatttacaatatccaatggtggtgtctatggaagccttttgagt
accccaattattaaccctccacagtcggctatactgggtatgcactcaatagtgactcga
ccaatggttgtcgggggcaacattgtcccaaggcccatgatgtacattgcattgacatat
gatcataggctgattgatggaagagaggcagttttcttcttgcgccgtattaaggatgtt
gtggaggatcctcgcaggttgcttcttgatatatga

DBGET integrated database retrieval system